KEGG   Taeniopygia guttata (zebra finch): 100225117Help
Entry
100225117         CDS       T01082                                 

Gene name
MINPP1
Definition
(RefSeq) multiple inositol-polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu00010  Glycolysis / Gluconeogenesis
tgu00562  Inositol phosphate metabolism
tgu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100225117 (MINPP1)
   00562 Inositol phosphate metabolism
    100225117 (MINPP1)
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     100225117 (MINPP1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     100225117 (MINPP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 His_Phos_1 DUF4708
Motif
Other DBs
NCBI-GeneID: 100225117
NCBI-ProteinID: XP_002187811
Position
6
AA seq 343 aa AA seqDB search
MWYEESMDGQLAPQGRLDMEQLARRMAARFPALFAARRRLELASSSKHRCLQSGAAFRQG
LGPTLDFGGDEVEIEVNDFLMRFFDHCAKFVAMVEENDKAMCQVTAFKEGPEMKKVLEKV
ASALCLPVEELNADLVQVAFLTCSYELAIKNVTSPWCSLFSEEDAKVLEYLNDLKQYWKR
GYGYDINRRSSCVLFQDIFQHLDKAVEESKSSKPISSPLIVQVGHAETLQPLLALMGYFK
DDEPLLASNYARQAQRKFRTGRIVPYAANLAFVLYHCDHVNSSQEEYQVQLLLNENLLPF
HHSNETISTYTDLKDYYKDILENCHFKEECELSQVNVTVVDEL
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgtggtacgaggagagcatggacgggcagctggcgccgcagggccggctcgacatggag
cagctggcccggcgcatggccgcccgcttccccgcgctcttcgccgcccgccgccgcctg
gagctggccagcagctccaagcaccgctgcctgcagagcggggccgctttccgccagggg
ctcgggcccaccctcgacttcggcggtgacgaggtggagattgaagttaacgacttcctg
atgcggttctttgatcactgcgccaagtttgtagccatggtggaggagaacgacaaggcc
atgtgccaggtgaccgccttcaaagaggggcctgagatgaagaaggttctggagaaggtg
gccagtgccttgtgtttgccagtggaggagctaaatgcagatcttgttcaagtggctttt
ctcacctgctcatacgagctggccataaaaaatgtgacctccccatggtgttcactcttc
agtgaagaagatgccaaggtgctggaatacctgaacgacctgaagcaatactggaagaga
ggatatggctatgacatcaacaggcgctccagctgtgttttattccaagatatcttccag
cacttggacaaagcagtggaggagagcaaaagctccaaacccatttcctcacctttgatt
gtccaagttgggcatgcagagaccctccagcccctgcttgccttgatgggttacttcaaa
gatgatgagcctctcctggccagcaactacgcccggcaggcgcagcggaaattccgcacc
ggccgcatcgtgccttacgcagccaacctggcgttcgtgctctaccactgcgaccacgtg
aactcctcccaggaggagtaccaggtacagctgctgctcaacgagaacctgctgcccttc
catcactccaacgagaccatctccacctacacggatctcaaggactactacaaggacatc
ctggaaaactgccacttcaaagaggagtgcgaattgtcccaagtcaacgtcactgttgtc
gatgagctgtga

DBGET integrated database retrieval system