KEGG   Taeniopygia guttata (zebra finch): 100225827Help
Entry
100225827         CDS       T01082                                 

Gene name
SUV39H2
Definition
(RefSeq) suppressor of variegation 3-9 homolog 2
  KO
K11419  histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100225827 (SUV39H2)
Enzymes [BR:tgu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100225827 (SUV39H2)
Chromosome and associated proteins [BR:tgu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100225827 (SUV39H2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100225827 (SUV39H2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET Chromo IGPS
Motif
Other DBs
NCBI-GeneID: 100225827
NCBI-ProteinID: XP_002190068
Ensembl: ENSTGUG00000002338
Position
1A
AA seq 417 aa AA seqDB search
MGCPGEVVKSPSLEVFTWYVPCLASLETLQELCRKENLTCKSIGITNRNLKSYEVEYLCD
YKVEEGKAFYLVKWKGWPESSNTWEPRKHLNCPLLIQNFLRDRNEYLSRGRGGKAMKLRK
HVKTLKPAIADYIVKKAKQRIALQRWKEELNRKKNHKAMILVENTVDLEGPPLDFYYINE
YKPAPGINVLNGITTGCECDDCPAEKCCPKEAGFILAYNKRKKLKIQPGLPIYECNSYCR
CGPDCLNRIVQKGTPYSLCIFRTNNGRGWGVKTLQKIKTNSFVMEYVGEVITSEEAERRG
QFYDNQGNTYLFDLDYDSDEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDLRLPRI
ALFSTRTIKAGEELTFDYQMKGSIDLTSDSAEGLTPSKKSIRTVCKCGAMCCRGYLN
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgggctgcccgggggaggtggtgaagtcaccgtccctggaggtgttcacctggtatgtg
ccatgtctagcttcacttgagaccctccaagaattatgtaggaaggaaaatctcacatgt
aaatccattggaatcaccaacaggaatctaaagagttatgaggtggaatatttgtgtgac
tacaaggtagaagagggcaaagcattctatcttgtgaaatggaaaggatggccagaatct
tcaaatacttgggaacctcggaaacatctgaactgtcctctgcttattcagaactttctt
agagacagaaatgaatacttgtctcgggggaggggaggcaaagcaatgaaactgagaaag
catgttaaaactttgaaacctgcaattgcagattatattgtaaagaaggccaaacaaaga
atagctctgcagaggtggaaagaagaactcaacaggaaaaagaatcacaaagcaatgatt
ctggtagaaaacactgtagatcttgaaggccctcctttagacttctactacatcaatgag
tataaacctgctccaggaataaatgtgctcaatggaataacaactggctgcgagtgtgat
gactgccctgctgagaagtgctgtccaaaggaggctgggtttattttggcttacaataaa
cgtaagaaattgaaaatccagcctggcttgcccatctatgagtgcaattcgtattgtagg
tgtgggcctgactgcctgaataggattgtgcagaaagggaccccatattcactctgcatc
ttcagaaccaacaacggccgtggctggggagtaaaaaccctccagaaaattaaaaccaac
agttttgtgatggagtatgttggagaggtgattacaagtgaggaagcagagaggcgaggc
cagttctatgacaaccagggaaatacatacctgtttgatttggactatgactcagatgaa
tttacagtagatgcagctcgatatggaaatgtgtcccattttgtgaaccacagttgtgat
ccaaatcttcaagtcttcaatgtgtttattgataacctcgacttgcgtcttcctcgaata
gcgctgttctctacccgaaccatcaaggctggagaagagctaacctttgactatcagatg
aaaggttcaatagatctgacttcagactctgctgaaggtcttaccccatccaaaaagagc
atcagaactgtctgtaaatgtggagccatgtgttgcagaggttatctcaactga

DBGET integrated database retrieval system