KEGG   Taeniopygia guttata (zebra finch): 100226028Help
Entry
100226028         CDS       T01082                                 

Gene name
DOCK7
Definition
(RefSeq) dedicator of cytokinesis protein 7 isoform X7
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tgu04131]
    100226028 (DOCK7)
Membrane trafficking [BR:tgu04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    100226028 (DOCK7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N TEA
Motif
Other DBs
NCBI-GeneID: 100226028
NCBI-ProteinID: XP_012430775
Position
8
AA seq 2129 aa AA seqDB search
MAERRAFAQKISRTVAAEVRKQISGQYGGSPQLLKNLNIGGSVSHHTTVPLTEAVDPVDL
EDYLNTHPLAVESGPLRDLLEFPRDDIEVVYTPRECRTLVSAVPEESEMDPHVRDCVRSY
TEDWAIVNRKYHKLGTGFNPNTLDKQKERQKGLPKQVFESDEAPDGNSYQDEQDDLKRRS
MSIDDTPRGSWACSIFDLKNSLPDALLPNLLDRTPNEEIDHHNEDQRKSSRHKELFALHP
APDEEEPIERLSVPEVPKEHFGQRLLVKCLSLKFEIEIEPIFASLALYDVKEKKKISENF
YFDLNSEQMKGMLRPHVPPAAISTLARSAIFSITYPSQDVFLVIKLEKVLQQGDIGECAE
PYMIFKESDAAKNKEKLEKLKGQAEQFCQRLGKYRMPFAWTAIHLMNIVSSAGSLERDST
EVEVGTGERKGSWSERRNSSIVGRRSLERTTSGDEACNLSSFRPATLTVTNFFKQEGDRL
SDEDLYKFLADMRRPSSVLRRLRPITAQLKIDISPAPENPHYCLTPELLQVKLYPDSRVR
PTREILEFPARDVYVPNTTYRNLLYVYPQSLNFANRQGSARNITVKVQFMYGEDPSNAMP
VIFGKSSCPEFSKEAYTAVVYHNRSPDFHEEIKIKLPATLTDHHHLLFTFYHVSCQQKQN
TPLETPVGYTWIPMLQNGRLKTGQFCLPVSLEKPPQAYSVLSPEVPLPGMKWVDNHKGVF
NVEVVAVSSLHTQDPYLDKFFALVHALDEHMFPVRIGDMRIMENNLENELKSSISALNSS
QLEPVVRFLHLLLDKLILLVVRPPVIAGQIVNLGQASFEAMASIINRLHKNLDGNQDQHG
RNSLLASYIYYVFRLPNTYPNSPSPGPGGLGGSVHYATMARSAVRPASLNLNRSRSLSNS
NPDISGTPTSPDDEVRSIIGTKGLDRSNSWVNTGGPKAAPWGSNPSPSAESTQATDRSCN
RMSSHTETSSFLQTLTGRLPTKKLFHEELALQWVVCSGSVREAALQQAWFFFELMVKSMV
HHLYFADKLDAARKNRFPERFMDDVSALVSTIAGDIVSRFQKDTEMVERLNTSLAFFLND
LLSIMDRGFVFALIKTCYKQVSSKVYSLTNPSNLASLKLDFLRIICSHEHYVTLNLPCSL
LTPPASPSPSVSSATSQSSGFSTNVQDQKIANMFELSVPFRQQHYLAGLVLTELAVILDP
DAEGLFGLHKKVINMVHNLLSSHDSDPRYADPQVKARVAMLYLPLIGVIMETVPQLYDFT
ESHNQRGRPSCVAVDDYESEGGSMINQTVAMAIAGTSVPQLTRPSSFLLPSSSGRQHSTF
STESSRSLLICLLWVLKNADESVLQKWFTDLSVLQLNRLLDLLYLCVSCFEYKGKKVFER
MNSLTFKKSKDMRAKLEEAILGSIGARQEMVRRSRGQLERSPSGSAFGSQENLRWRKDMT
HWRQNTEKLDKSRAEIEHEALIDGNLATEANLIILDTLEIVVQTVSVTESKESILGGVLK
VLLHSMACNQSALYLQHCFATQRALVSKFPELLFEEETEQCADLCLRLLRHCSSSVNTIR
SHASASLYLLMRQNFEIGNNFARVKMQVTMSLSSLVGTSQNFNEEFLRRSLKTILTYAEE
DLELRETTFPDQVQDLVFNLHMILSDTVKMKEHQEDPEMLIDLMYRIAKGYQNSPDLRLT
WLQNMAGKHSERSNHAESAQCLVHSAALVAEYLSMLEDRKYLPVGCVTFQNISSNVLEES
AVSDDVVSPDEEGICSGKYFTEAGLVGLLEQAAASFSMAGMYEAVNEVYKVLIPIHEANR
DAKKLSTIHGKLQEAFSKIVHQDGKRMFGTYFRVGFYGTKFGDLDEQEFVYKEPAITKLA
EISHRLEGFYGERFGEDVLEVIKDSNPVDKCKLDPNKAYIQITYVEPYFDTYEMKDRITY
FDKNYNLRRFMYCTPFTLDGRAHGDLHEQFKRKTILTTSHAFPYIKTRINVIHKEEIILT
PIEVAIEDMQKKTQELAFATHQDPADPKMLQMVLQGSVGTTVNQGPLEVAQVFLAEIPND
PKLFRHHNKLRLCFKDFTKRCEDALRKNKSLIGPDQKEYQRELERNYHRLKEALQPLINR
KIPQLYKAVLPVTCHRDSFSRMSLRKMEI
NT seq 6390 nt NT seq  +upstreamnt  +downstreamnt
atggccgagcgccgcgccttcgcccagaagatcagcaggaccgtggcagccgaggtcagg
aagcagatttcggggcagtatggaggctccccacagctcctcaagaacctcaacatcgga
ggcagcgtctcccatcacaccactgtgcctctcacagaagctgtggaccctgtggacctg
gaggactatctcaacacccaccctctggccgtggagtcggggcccctgcgggacctgctg
gagtttccccgcgatgacatcgaggtggtttacaccccccgcgagtgccggacgctggtg
tcggccgtgcccgaggagagcgagatggaccctcacgtgagggactgtgtcaggagttac
acggaggactgggcgatcgtgaacagaaaataccacaagctgggaactgggttcaatccc
aacaccttggacaaacagaaggagaggcaaaaagggctccccaaacaggtcttcgagtct
gacgaagctcctgatggcaacagctaccaggatgaacaagatgacctcaagcgccgctca
atgtcgatcgacgacactccccggggcagctgggcctgcagcatcttcgacctgaagaac
tccctgcctgatgccctcctcccaaacctgctggacagaaccccaaacgaggagattgac
caccacaacgaggaccagaggaagtccagtaggcataaggagctttttgcactacaccca
gcaccagatgaggaggagcccatagagagactcagtgtccctgaagtacccaaagagcac
tttggccaaagactcctggtgaagtgtttgtccctgaaatttgaaatagaaattgagccc
atttttgcaagtttggctttgtatgatgttaaagaaaagaagaagatttcagagaatttc
tactttgatttaaactctgagcaaatgaagggaatgcttcggcctcatgtcccccctgct
gctatttccaccctggccagatctgccatcttttctatcacctacccatcccaagatgtc
tttctagtaataaagctggaaaaagttttacagcagggagatattggggagtgtgcagag
ccttatatgatttttaaagaatctgatgcagcaaagaacaaggaaaagttggaaaaactg
aagggccaggcagaacagttttgccaaagactcgggaagtaccggatgccttttgcctgg
acagccattcacctcatgaacattgtgagcagtgctggcagcttggaaagagattccaca
gaagttgaagttggcacaggagagcgtaaggggtcgtggtcggagcggcggaactccagc
atcgttgggaggcgctccctggagaggaccacgagtggggacgaggcttgcaacctgagc
agcttcaggccagccaccctgacagtgaccaacttcttcaaacaggagggggatcgcctg
agcgatgaggacctgtacaagttcctggctgacatgagacgtccctcgtcggtgctgcgc
aggctcagacccatcacagctcagttgaagatagacatatctccagctccagagaacccc
cactactgcctaaccccagagctgctgcaggtcaagctttacccagacagcagagtcaga
ccaacaagagaaatcctggagttccctgccagggatgtctacgtcccaaacaccacatac
aggaatctcctttatgtgtacccacagagccttaacttcgccaaccgccagggatctgcc
aggaacatcacagtgaaagtgcagttcatgtatggagaggatcccagcaatgccatgccg
gtcatctttggcaaatccagctgtcctgagttttccaaggaagcctacacagctgtggtg
tatcacaacagatctcctgattttcacgaagaaatcaagattaagcttccagccactttg
acagaccaccaccacctactttttactttctaccatgtcagttgccaacaaaaacaaaac
acacctctggagactccagtcggctacacttggatcccgatgctgcagaatggccggtta
aagacgggtcagttctgtcttcctgtgtcattggaaaagccaccacaggcttattcagtg
ctttctccagaggttcctctccctgggatgaagtgggtggataaccacaaaggggttttc
aatgtggaagttgttgctgtgtcatccctccacactcaggacccttacctcgacaagttc
tttgcacttgtccatgctctggatgagcacatgttccctgtgcgaataggagacatgaga
attatggaaaacaacttggaaaatgaactgaagagcagcatttcagctttaaattcctct
caactggagccggtagtgcgatttcttcatctcctgcttgacaaactgatccttctggta
gtaagacctcctgtcattgcaggccaaatagtgaacctgggccaagcatcttttgaggcg
atggcatcgatcataaacagacttcacaagaatttggatggcaaccaggaccagcatggc
aggaacagcctgcttgcttcctatatttattatgtttttcgcctacccaacacctatccc
aactcaccatcaccaggtcccggcggcctgggggggtcggtgcactacgccaccatggcc
aggtcggccgtgcgccccgccagcctcaacctgaaccgctcgcgcagcctcagcaacagc
aaccccgacatctccggcacccccacctcgcccgacgacgaggtgcgctccatcatcggc
accaagggcttggaccgctccaattcctgggtaaacactggtggtccaaaagcagcccca
tggggatccaaccccagcccaagtgcagagtcaacacaggctacggatcgaagttgtaat
cgtatgtcttcgcacactgagacgtcaagtttcttacaaacattaacaggacgattacca
accaaaaagcttttccacgaggagctggccctgcagtgggttgtgtgcagcgggagcgtg
cgggaggcggccctgcagcaggcctggttcttcttcgagctgatggtgaagagcatggtg
catcatttgtattttgctgacaaactggatgcggcgaggaagaatcgtttcccggagcgc
ttcatggatgacgtgtctgcactggtcagcacaattgctggtgatatagtctcccgcttc
cagaaggacacggaaatggtggagcggctcaacaccagtctcgcgtttttcctcaatgat
ttgctgtccatcatggacagaggatttgtttttgctcttattaagacctgctacaaacag
gtgtcttcaaaggtgtattccttaacaaatccaagcaacctggcatctctgaagctggac
ttcctgcgcatcatttgcagccatgagcactatgtcaccttgaatttaccctgcagcttg
ctcacaccacctgcatctccatcaccatctgtgtcttcagccacttcccagagttctggg
ttctccaccaatgtccaagaccagaagattgcaaatatgtttgagttgtctgtgcctttc
cgccagcagcattacctggccgggctggtgctcacagaactggctgtcattctagatcct
gatgcagaaggtttatttggattgcataagaaggtcatcaacatggtacacaacctgctg
tccagccacgactcggacccgcggtacgctgacccccaggtaaaggcccgggtggcaatg
ctgtatctacctctgatcggcgtgatcatggaaactgtgcctcagctctatgacttcaca
gagagtcacaaccagcgggggaggccgagttgtgtcgctgtggacgattacgagagtgag
ggtggcagcatgatcaaccagacagtggccatggccattgcagggacttctgtcccccag
ctcaccaggcccagcagtttcctactcccttcttcgagtggcaggcagcactccaccttc
tcaacagagtccagccgcagcctcctcatctgcctgctctgggtgctgaagaacgcggac
gagagcgtcctgcagaagtggttcactgacctgtcagtgctgcagctcaaccgcctgctg
gacctgctctatctctgtgtctcctgctttgagtacaagggcaagaaagtgtttgaaaga
atgaacagtctgacatttaagaagtcaaaagacatgagagccaaacttgaagaagcaatt
ttgggcagcataggagcaaggcaggaaatggtccgaagaagtagaggacagctggagagg
agcccttctgggagtgcctttggaagtcaagagaatctgagatggagaaaggatatgact
cactggcggcagaacacagagaagcttgacaagtcaagggcagagatagaacatgaagca
ctcatcgatgggaatcttgcaacagaagccaacctgataattttggatactctagagata
gttgtacagaccgtgtccgtgacggagtccaaggagagcatcctcggcggggtgctcaag
gtgctgctgcacagcatggcctgcaaccaaagtgccctttacctccagcactgctttgcc
acacagagagctttggtctcaaagttccctgagctgctgtttgaggaggagacagagcag
tgtgcagacctgtgcctgaggctcctgaggcactgcagcagcagcgtcaacaccatcagg
tcccacgccagtgcctccctgtacctcctcatgaggcagaacttcgagattggcaacaat
tttgccagggtgaagatgcaggtgaccatgtccctctcatccctggtggggacatcccag
aacttcaatgaagaatttctgcggcgttccctcaagactattctgacatatgctgaagag
gatctggaacttagggagacaacatttcctgaccaggtccaggatttagtgttcaacctg
catatgatcctgtcagacacagttaaaatgaaggagcaccaggaagatccagaaatgctg
attgacctgatgtacaggattgccaagggctaccagaattcccccgacctgaggctgacg
tggctgcagaacatggcagggaaacattctgagaggagcaaccacgccgagtctgcccag
tgcctggtgcactctgcagccctggtggcagagtacctgagcatgctggaggacaggaaa
tacctccctgtgggctgtgtgacattccagaacatatcttccaatgttctggaagagtca
gcagtttctgatgatgttgtgtccccagatgaagaaggaatctgttctgggaagtatttt
acagaagctggtctggtgggattgctggaacaggctgcagcatctttctccatggctggc
atgtatgaagcagttaatgaggtttacaaagtccttattcctattcatgaagccaacaga
gatgccaagaagttgtctactattcatggtaaactgcaggaagcattcagcaagattgtt
caccaggatggaaagaggatgtttggcacctacttccgagttggtttttatggaacgaag
tttggagacctggatgagcaagagtttgtttacaaggaacctgcaataaccaagttggct
gaaatctcccatcggctggagggattttatggagaacggtttggggaagatgtgctggaa
gtgatcaaggactcaaaccctgtggacaaatgtaaacttgatcccaacaaggcctacatc
cagatcacctacgtggagccctacttcgacacgtacgagatgaaggacaggatcacctac
ttcgacaagaactacaacctgcggcgcttcatgtactgcacgcccttcacgctggacggc
cgcgcccacggcgacctgcacgagcagttcaagcgcaagaccatcctcaccacctcccac
gccttcccctacatcaaaaccaggatcaacgtcatccacaaggaggagatcattttgacc
cccattgaagttgccatcgaggacatgcagaagaaaacccaggaattggcttttgccacc
caccaagaccctgcagaccccaagatgctgcagatggtgctgcagggatcagtaggtacc
acagtgaaccagggaccattagaagttgcacaagtgttcttggctgaaatccccaatgat
ccaaagctcttcagacaccacaacaaactccgcctctgcttcaaggacttcaccaaaagg
tgtgaggatgccctgaggaagaacaagagcctgatcgggccggaccagaaggaatatcag
cgggagctggagcgcaactaccaccggctcaaggaggctctgcagcccctgatcaacagg
aagatcccacagctctacaaggcagtgctgcctgtcacgtgccacagagactccttcagc
aggatgagccttcgcaaaatggaaatctaa

DBGET integrated database retrieval system