KEGG   Taeniopygia guttata (zebra finch): 100226080
Entry
100226080         CDS       T01082                                 

Symbol
ADCY1
Name
(RefSeq) adenylate cyclase type 1 isoform X1
  KO
K08041  adenylate cyclase 1 [EC:4.6.1.1]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu00230  Purine metabolism
tgu01100  Metabolic pathways
tgu04020  Calcium signaling pathway
tgu04114  Oocyte meiosis
tgu04261  Adrenergic signaling in cardiomyocytes
tgu04270  Vascular smooth muscle contraction
tgu04371  Apelin signaling pathway
tgu04540  Gap junction
tgu04912  GnRH signaling pathway
tgu04914  Progesterone-mediated oocyte maturation
tgu04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100226080 (ADCY1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100226080 (ADCY1)
   04020 Calcium signaling pathway
    100226080 (ADCY1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100226080 (ADCY1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100226080 (ADCY1)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    100226080 (ADCY1)
   04914 Progesterone-mediated oocyte maturation
    100226080 (ADCY1)
   04916 Melanogenesis
    100226080 (ADCY1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100226080 (ADCY1)
   04270 Vascular smooth muscle contraction
    100226080 (ADCY1)
Enzymes [BR:tgu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100226080 (ADCY1)
SSDB
Motif
Pfam: Guanylate_cyc AC_N Adcy_cons_dom HNOBA TBK1_ULD
Other DBs
NCBI-GeneID: 100226080
NCBI-ProteinID: XP_002192043
Ensembl: ENSTGUG00000007142
Position
2:74062967..74230655
AA seq 1142 aa
MNGTDMEEIPFQKVKTKRKKCCHCCCSPPAAAASGAGVGLGDSPPLLLLDAIACEDEFDC
KELEALFQSYNLKLEQTSTLKALAVLIVLTASLALVELLSGPSLTISKGSHPVHCIIFLS
LFIVTNVKYLQVTQLQQIVKLTLLFSFTFSFLCCPFSLGAYGMEPPSTPEEGMWQLMLVT
FVSYSLLPVRTLLAIVFGLVVSVSHLIVTATSVSTKRQRLWRTLVANAILFVIVNLYGVF
VRILTERAQRKAFLQARNCIEDRLRLEDENEKQERLLMSLLPRNVAMEMKEDFLKPPERI
FHKIYIQRHDNVSILFADIVGFTSLASQCTAQELVKLLNELFGKFDELATENHCRRIKIL
GDCYYCVSGLTQPKTDHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRVLCGVLG
LRKWQYDVWSNDVTLANVMEAGGLPGKVHITKTTLECLNGDYEVEPGYGHERNSFLKKHN
IETYFIVPSHRRKIFPGLILSDIKPAKRMKFKTVCYLLVQLMHCRKMFKAEIPFSNVMTC
EDDDKRRALRTASEKLRNRSSFSNNIVYNTPGTRVNRYISRLIEARQTESEMADLNFITL
KYKQIERENKYHQLQDEYFTSAVALSLILAALFGLVYLLIIPQSTVVLVLLVFCICFLVA
CIMYLHVTRVQCFPGCLTIQIRTILCIFIVILIYSVAQGCVVGCMPWVWNTNSSSSIIII
SPGGTNKTMNELPCDTAHYAFLSCVVGTLTLAIFLRVSSLPKIILLLFVTILYIVILELS
GYRKAVGGGSFYMRGYEPILAILLFSCALALHSRQVDLKLRLDYLWAVQAEEERDDMERV
KLDNKRILFNLLPAHVAQHFLMSNPRNMDLYYQSYSQVGVMFASIPNFNDFYIELDGNNM
GVECLRLLNEIIADFDELMDKEYYKDIEKIKTIGSTYMAAVGLVPTSGTKAKKSIYSHLS
TLADFAIEMFDVLDEINYQSYNEFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNVASRM
DSTGVQGKIQVTEEVQRILKRCSYEFVCRGKVSVKGKGEMLTYFLEGKADVNNSQTRSLN
LERKMYPYGRANIQTKLGTSCPSVSSVASFTVKSGHGAGQASATHTNQTLHYLPSVPAVK
EA
NT seq 3429 nt   +upstreamnt  +downstreamnt
atgaatggcactgacatggaggaaataccgtttcagaaagtcaagaccaagaggaagaag
tgctgccactgctgctgctccccgcccgctgccgcggcgtcgggagcgggagtcgggtta
ggggattcccctcctttgctgctgctggatgccatcgcctgcgaggacgagtttgattgc
aaggagctggaggctctctttcagagctacaacctgaagctggagcagacgtccaccctc
aaggcgctggccgtcctcatcgtgctcaccgccagcctagccctggtggagctgctctcc
ggccccagcctgaccatctccaaaggttcgcacccggtgcactgcatcatcttcctctcc
cttttcatcgtcacaaatgtcaagtacctgcaggtcacccagctgcagcagatcgtcaag
ctcaccttgctcttcagcttcaccttctccttcctatgctgccccttctctctcggcgcc
tatggcatggagccgcccagcacccccgaggagggcatgtggcagctcatgctggtaacc
ttcgtctcctactcgctgcttcccgtccggacgctgctggccatcgtcttcgggctggtg
gtgtccgtctcccacctcatcgtcaccgccacttccgtcagtaccaagcggcagaggctc
tggaggacgcttgtggccaatgcaatcctttttgtcattgtaaatttgtatggggtcttt
gtgaggattttgacagaaagggctcagaggaaggcattccttcaggccaggaactgcatt
gaggacaggctgagactggaggatgaaaatgaaaaacaggaacgtctcttgatgagcctt
ttgcccaggaatgttgcaatggaaatgaaggaagacttcctgaagcctcctgaaaggatt
ttccacaagatttacattcaaaggcatgacaatgttagtattttatttgcagacattgtg
gggttcactagtttggcatcacagtgtactgcccaagagctagtgaagctgctgaatgag
ctttttggaaaatttgatgaattagctacagaaaatcattgcagaagaataaaaatccta
ggggactgttactactgtgtatcaggattgactcaacccaagacagatcatgcccattgc
tgtgttgaaatgggactggatatgattgacaccatcacatctgttgcagaagccacagag
gttgatctcaacatgagagttggattgcatacaggcagggttctttgtggggtcctgggt
ctccgaaaatggcaatatgatgtctggtcaaatgatgtgacattagctaatgtaatggaa
gctggaggactgcctgggaaagttcacattacaaagaccaccttagagtgcctaaatggg
gactatgaggtagaaccaggatatggtcatgaaaggaatagtttcttgaagaagcataat
attgaaacatattttattgtgccatcccatcgtaggaagatatttcctggactgattctc
tcagacattaagcctgccaaaagaatgaagttcaagacagtgtgctatctgcttgttcag
ctcatgcactgtcgcaagatgttcaaagcggagatccctttctccaacgtcatgacgtgt
gaggatgatgataagaggagagcattaaggacagcctctgaaaaactcaggaatcgctcg
tctttttctaacaatattgtatacaacactccgggaactcgagtgaacagatatatcagc
cgcttgatagaggcccggcaaactgagtctgagatggctgacttgaatttcattaccttg
aagtataagcaaattgagcgtgaaaataaataccaccagcttcaggatgagtacttcact
agtgctgtagctctctcgctaattctagctgccttatttggccttgtctaccttctaata
ataccacagagtactgtagttcttgttctcctggtgttctgcatatgcttcctagtggct
tgtattatgtacctacatgtcacacgagtacaatgttttccagggtgcctgacaatacaa
attcgtaccattttgtgtatttttattgtgatcttaatatactctgtggctcaaggctgt
gtggttggctgcatgccttgggtttggaataccaattccagcagctcaataattataatt
tctcctggtggaacaaataaaactatgaatgaacttccatgtgacacagcccactatgct
ttcctttcctgtgtagtggggactctcaccttggcaatatttctacgtgtatcttccttg
ccaaaaattattctcctgctttttgttacaattttgtacatagttattctggaactcagt
ggttacagaaaagcagtagggggcggctccttttatatgcgtggctatgaaccaatacta
gctattttgctattttcttgtgctttagcactgcattcaagacaggtggacttgaaactg
cgtctggactacctctgggcagtgcaggcagaagaagagagagatgatatggagagagtc
aagctggataataaaagaattcttttcaatctgttgccagcccacgttgcacagcatttt
cttatgtctaatccaagaaatatggacctttattaccagtcatattcacaagtgggagtg
atgtttgcttccatcccaaatttcaatgatttctacatcgaattggatggcaataacatg
ggagttgaatgtttacgcctgttaaatgaaattattgctgattttgatgagcttatggac
aaagaatattataaagatattgaaaagatcaagacaattggaagtacttatatggcagct
gtgggacttgtacctacttcaggaactaaggctaaaaaatcaatttattcccatttgagt
acactggcggattttgcaatagagatgtttgacgttcttgatgaaatcaactatcagtct
tacaatgaatttgtcctacgagttggtattaatgttgggccggtagtggcaggagtcatt
ggagccagaagaccacagtatgatatctgggggaacactgtgaatgttgccagccggatg
gatagtactggagttcagggaaagattcaggtgacagaagaagttcagcggatattaaaa
agatgcagttatgaattcgtgtgcaggggtaaagttagtgtaaagggaaaaggtgaaatg
ttaacctatttcctggaaggaaaggctgatgtaaataattcccaaacgcggtcactaaac
ttagagcggaaaatgtacccttatgggagagcaaacattcaaacaaaattgggcaccagc
tgtccatcggtgtcctctgttgctagctttactgtaaaatctggtcatggagcaggtcag
gcatctgccactcacactaaccaaacactgcattatcttccttctgtgccagctgtgaag
gaggcatag

DBGET integrated database retrieval system