KEGG   Taeniopygia guttata (zebra finch): 100226102Help
Entry
100226102         CDS       T01082                                 

Gene name
PDK3
Definition
(RefSeq) pyruvate dehydrogenase kinase 3
  KO
K00898  pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
Enzymes [BR:tgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     100226102 (PDK3)
Protein kinases [BR:tgu01001]
 Serine/threonine kinases: Other
  PDHK family [OT]
   100226102 (PDK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BCDHK_Adom3 HATPase_c HATPase_c_3
Motif
Other DBs
NCBI-GeneID: 100226102
NCBI-ProteinID: XP_002195389
Ensembl: ENSTGUG00000007181
UniProt: H0ZA13
Position
1
AA seq 406 aa AA seqDB search
MRLCGAMLKSPIPKQIEYYSRFSPSPLSIKQFLDFGRDNACEKTSYMFLRKELPVRLANT
MREVNLLPDNLLNRPSVGLVQSWYMQSFLELLEYENKSPEDPHVLDDFLDVLIKVRNRHN
DVVPTMAQGVIEYKEKYGFDPFVSSNIQYFLDRFYTNRISFRMLINQHTLLFGGDINPAH
PKHIGSIDPNCDVTEVVKDAYETAKMLCEQYYTVAPDLEIEEFNAKAPNKPIQVVYVPSH
LFHMLFELFKNSMRATVELHEGKKEAYPSIKTLVTLGKEDLSIKISDQGGGVPLRKIERL
FNYMYSTAPRPSLEPSRAVPLAGFGYGLPISRLYARYFQGDLKLYSMEGVGSDAVIYLKA
LSSESFERLPVFNKSAWRHYKTTPEADDWSNPSSEPRDASKYKANR
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgaggctgtgcggggcgatgctcaagagccccatccccaagcagatcgagtactactcg
cgcttctccccctcgcccctctccatcaagcagttcctcgacttcggtcgtgacaatgcc
tgtgagaagacttcgtacatgttcctgcggaaggagcttcctgtgcgactggcgaacacc
atgagggaagtcaatttgctgcctgataatttactgaacaggccttcggttgggctggta
cagagctggtacatgcagagtttccttgagcttttagaatacgaaaataaaagtcctgag
gatcctcatgttctggatgactttttagatgttttaattaaagtcaggaacagacacaat
gacgtggttccaaccatggcacaaggggtgattgaatacaaggaaaaatatggctttgat
ccatttgttagcagtaacatccagtattttctagatagattctacaccaaccgcatctct
tttcgtatgcttattaaccaacacacacttctgtttggtggagatattaatcctgctcat
cccaaacatattggaagtattgatcctaattgtgatgtgacagaggtggttaaagatgct
tatgaaacagctaagatgttatgtgaacagtactataccgtggcacctgatctggaaatt
gaagaattcaatgctaaagctcccaacaagcctattcaagtagtctatgtaccttctcat
ttgtttcatatgttatttgaattattcaagaattcaatgagagctacagtggaattgcat
gaaggtaagaaagaagcctatccatcgatcaaaaccttagtcactttggggaaagaagat
ctatctattaagataagtgaccaaggtggaggtgtacctctaagaaaaatagagagattg
tttaactacatgtactcaacagcacccaggcccagtctggagccctcgagggctgtgcct
ttggctgggtttggctatgggttgccaatttctcgtctgtatgcgaggtactttcaaggt
gaccttaaactctactcaatggaaggtgtgggttcagatgctgttatttatttgaaggcc
ctttcaagtgaatcatttgaaagacttcctgtttttaataagtcagcatggcggcactac
aagaccacacctgaagcagatgactggagcaatcctagcagtgaaccaagggatgcttct
aaatacaaagctaatcgataa

DBGET integrated database retrieval system