KEGG   Taeniopygia guttata (zebra finch): 100227204Help
Entry
100227204         CDS       T01082                                 

Definition
(RefSeq) sphingosine kinase 1-like
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu00600  Sphingolipid metabolism
tgu01100  Metabolic pathways
tgu04020  Calcium signaling pathway
tgu04370  VEGF signaling pathway
tgu04371  Apelin signaling pathway
Module
tgu_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100227204
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    100227204
   04371 Apelin signaling pathway
    100227204
   04020 Calcium signaling pathway
    100227204
Enzymes [BR:tgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     100227204
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat 7tm_2
Motif
Other DBs
NCBI-GeneID: 100227204
NCBI-ProteinID: XP_012431781
Position
Un
AA seq 328 aa AA seqDB search
MLAEADIATTVFITERPHHAHEKVRDEDLSQWDTLVVVSGDGLLFEVVNGLMERPDWKEA
MKKPLCILPGGSGNALAASINYYAGYDHVAKKKLLTNCTFILCKGLYTQMDLVSLSTASG
KRFFSFLGFGWGFISDVDIDSEKYRWLGSARFTLGTLQCLAKLRVYQGRLSYLPVAAEQG
IAPALRDAPVPVTNGRVPEPAGTEAPGSPPPDSLLVPLGQPVPPHWTVVPEEEFVLVYAI
YQSHLGTNLLMAPAARLHDGCIHLFYMKAGISRVTLLKLFLAMSRGTHLDLNCPHLSYVP
VRAFRLEPRVAAGIMTVDGEALVCEPVQ
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgctggctgaggctgacattgccaccactgtcttcatcaccgaaagaccccaccatgcg
cacgagaaggtgcgagatgaggacctgtcgcagtgggacacgttggtggtcgtgtctggg
gacgggctgctgttcgaggtggtgaacgggctgatggagcgtccggactggaaggaggcc
atgaagaagccgctgtgcatcctgccaggaggctctgggaacgccctggctgcctctatc
aactactatgcaggctacgaccacgttgccaagaaaaagctgctgacgaactgcaccttc
atcctgtgcaaggggctgtacacgcagatggacctggtgtcgctgagcacggcctcgggc
aagcgcttcttctccttcctgggctttggctggggcttcatctcggacgtggacatcgac
agcgagaagtaccgctggctgggcagcgcccgcttcaccctgggcacgctgcagtgcctg
gccaagctccgggtgtaccagggccgcctgtcctacctgcccgtggccgcggagcagggc
attgccccggccctgagggacgcccccgtgcccgtcaccaacggccgcgtccctgagccc
gcgggcaccgaggcgcccggctcgccgccccccgactcgctgctggtgccgctgggccag
cccgtgccgccgcactggaccgtggtccccgaggaggagttcgtcctggtctacgccatc
taccagtcccacctgggcaccaacctgctgatggcaccggcggcccggctgcacgacggc
tgcatccacctcttctacatgaaggccggcatcagccgcgtgacgctgctgaagctcttc
ctggccatgtccagggggacccacctggacttgaactgtccccacctgtcctacgtcccg
gtgcgggcgttccgcctggagccgcgcgtggccgcgggcatcatgacggtggatggagag
gcgctggtctgcgagcccgtgcag

DBGET integrated database retrieval system