KEGG   Taeniopygia guttata (zebra finch): 100227204Help
Entry
100227204         CDS       T01082                                 

Gene name
SPHK1
Definition
(RefSeq) sphingosine kinase 1
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu00600  Sphingolipid metabolism
tgu01100  Metabolic pathways
tgu04020  Calcium signaling pathway
tgu04370  VEGF signaling pathway
tgu04371  Apelin signaling pathway
Module
tgu_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    100227204 (SPHK1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    100227204 (SPHK1)
   04371 Apelin signaling pathway
    100227204 (SPHK1)
   04020 Calcium signaling pathway
    100227204 (SPHK1)
Enzymes [BR:tgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     100227204 (SPHK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 100227204
NCBI-ProteinID: XP_030143210
Position
18
AA seq 517 aa AA seqDB search
MAAGRRAPPEPGGGPVLLQGIFGAGPAPGAAACSLWLTARELQVRRAGGCPGGSAGTDAA
LRLADCVGSAAFPAAAAAACFSLVCYPLRGPRWGPPARQRLERTFRVSRAPDAEGNLRIA
QAWSRRIRELAVPAVPAQDGDSYGVLPRPCHALVLLNPQSGSGRALDDFQAVVQPMLAEA
DIATTVFITERPHHAHEKVRDEDLSQWDTLVVVSGDGLLFEVVNGLMERPDWKEAMKKPL
CILPGGSGNALAASINYYAGYDHVAKKKLLTNCTFILCKGLYTQMDLVSLSTASGKRFFS
FLGFGWGFISDVDIDSEKYRWLGSARFTLGTLQCLAKLRVYQGRLSYLPVAAEQGSAPAP
RDVPAPVTNGRVPEPAGTEAPGSPPPDSLLVPLGQPVPPHWTVVPEEEFVLVYAIYQSHL
GTNLLMAPAARLHDGCIHLFYMKAGISRVTLLKLFLAMSRGTHLDLNCPHLSYVPVRAFR
LEPRVAAGIMTVDGEALACEPVQGQVHARLCRVLSGS
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggccgccggccgccgcgctcccccggagcccggcgggggcccggtgctgctccaaggc
atcttcggcgcggggccggcccccggtgccgccgcctgctcgctgtggctgacggcccgg
gagctgcaggtgcggcgtgccggcggctgcccgggcggctcggccggtaccgacgccgcg
ctccgcctggccgactgcgtgggctcggccgccttccccgcggccgcggccgccgcctgc
ttctcgctggtgtgttacccgctgagggggccgcgctggggcccgcccgcccgccagcgc
ctggagcggaccttccgcgtctcccgggctcccgacgctgagggcaacctgcgcatcgcc
caggcctggagccgccgcatccgtgagctcgccgtgcccgccgtgcccgcgcaggacggt
gacagctatggggtgctgccccggccctgccacgcgctggtgctgctgaacccacagagc
ggctctggccgtgccctcgatgacttccaggcggtggtgcagcccatgctggctgaggct
gacattgccaccactgtcttcatcaccgaaagaccccaccatgcgcacgagaaagtgcga
gatgaggacctgtcgcagtgggacacgttggtggtcgtgtctggggacgggctgctgttc
gaggtggtgaacgggctgatggagcgtccggactggaaggaggccatgaagaagccgctg
tgcatcctgccaggaggctctgggaacgccctggctgcctctatcaactactatgcaggc
tacgaccacgttgccaagaaaaagctgctgacgaactgcaccttcatcctgtgcaagggg
ctgtacacgcagatggacctggtgtcgctgagcacggcctcgggcaagcgcttcttctcc
ttcctgggctttggctggggcttcatctcggacgtggacatcgacagcgagaagtaccgc
tggctgggcagcgcccgcttcaccctgggcacgctgcagtgcctggccaagctccgggtg
taccagggccgcctgtcctacctgcccgtggccgcggagcagggcagcgccccggccccg
agggatgtccccgcgcccgtcaccaacggccgcgtccctgagcccgcgggcaccgaggcg
cccggctcgccgccccccgactcgctgctggtgccgctgggccagcccgtgccgccgcac
tggaccgtggtccccgaggaggagttcgtcctggtctacgccatctaccagtcccacctg
ggcaccaacctgctgatggcaccggcggcccggctgcatgacggctgcatccacctcttc
tacatgaaggccggcatcagccgcgtgacgctgctgaagctcttcctggccatgtccagg
gggacccacctggacttgaactgtccccacctgtcctacgtcccggtgcgggcgttccgc
ctggagccgcgcgtggccgcgggcatcatgacggtggatggggaggcgctggcctgcgag
cccgtgcagggccaggtccatgcccgcctctgccgcgtcctcagcggctcctga

DBGET integrated database retrieval system