KEGG   Taeniopygia guttata (zebra finch): 100227284Help
Entry
100227284         CDS       T01082                                 

Gene name
MTMR6
Definition
(RefSeq) myotubularin related protein 6
  KO
K18083  myotubularin-related protein 6/7/8 [EC:3.1.3.64 3.1.3.95]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu00562  Inositol phosphate metabolism
tgu01100  Metabolic pathways
tgu04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100227284 (MTMR6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    100227284 (MTMR6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tgu01009]
    100227284 (MTMR6)
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     100227284 (MTMR6)
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     100227284 (MTMR6)
Protein phosphatases and associated proteins [BR:tgu01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    100227284 (MTMR6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related Y_phosphatase DSPc DUF2353 Y_phosphatase3 VRR_NUC
Motif
Other DBs
NCBI-GeneID: 100227284
NCBI-ProteinID: XP_002191257
Ensembl: ENSTGUG00000011465
UniProt: H0ZMK0
Position
1
AA seq 622 aa AA seqDB search
MEHIRTTKVEQVKLLDRFSTSNKSLTGTLYLTATHLLFIDSSQRETWILHHHIAAVEKLP
LTTSGCPLVIQCKNFRIVHFVVPRERDCHDIYNSLLQLSRTAKYEELYAFSYNPKQNESE
QVKGWQLIDLAEEYKRMGVPNDYWQLSDANRDYKICETYPRELYVPRTASKPIIVGSSKF
RSKGRFPVLSYYHKNKEAAICRCSQPLSGFSARCLEDEHMLQAISKANPSNRYMYVMDTR
PKLNAMANRAAGKGYENEDNYSNIRFQFVGIENIHVMRSSLQKLLEVSGTRGLSVNDFLS
GLENSGWLRHIKAVLDAAVFLAKAIAVESASVLVHCSDGWDRTSQVCSLGALLLDSYYRT
IKGFMVLIEKDWISFGHKFSDRCCQLDGDPKEISPVFTQFLESVWNLTEQFPQAFEYNEA
FLLQIHEHVHSCQFGNFLGNCQKEREELKLKEKTYSLWPFLLSEQKKYQNPLYNPDFSPE
LTLLEPNTVSFNFKFWRNMYHQFDRSMHPRQSVFNLIMNTSEQNKQLEEDIKELEAKIKQ
RNGRSDVVLVKEQERTADPAPVALKSPPCFQKEQPPMPVNDAVRTIEGSNTADNRYSELV
SEFSKAEPAVVSLEYGVARMTC
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atggagcacatccgcaccaccaaggtagagcaagtgaaattactggataggttcagcaca
agcaataagtcactgacgggaactctgtatcttacagcaactcatctgttattcatagat
tcaagccagagagagacgtggatactacatcatcatattgctgcagtggaaaaacttccc
ttgactacttctggctgcccccttgtcatccagtgcaagaacttcaggatagttcacttt
gttgtacccagagagagagattgtcatgacatttataattctttgcttcagctctcaaga
acagcaaaatacgaagaactgtatgccttttcttataatccaaaacaaaatgaatctgag
caagtcaaaggttggcagcttatagatctagcagaagaatataagagaatgggagtgcca
aatgattactggcagttgtctgatgcaaatcgtgattacaagatttgtgaaacgtatcct
agagaactttatgttcccagaactgcaagcaagcctataattgttggtagctccaagttc
agaagcaaaggaagattcccagtgttgtcatattatcataaaaataaagaggctgcaatt
tgcagatgcagtcagcctctctcaggtttcagtgccaggtgcctggaagatgagcacatg
ttgcaagccatcagtaaagcaaatccttcaaatcgctacatgtacgtcatggacaccagg
cccaagcttaatgcaatggctaacagagctgctgggaagggctatgagaatgaagacaac
tactcaaacattaggttccagtttgttggcattgaaaatattcatgtaatgagatctagc
ctgcaaaaactcctggaagtcagtggcacaaggggtttgtctgtcaatgactttttgtct
ggtctggagaattctggatggctgcgtcacatcaaagctgtgttggatgctgctgtcttc
ctagccaaggcaatagcagttgagagtgcaagtgtattggtgcactgttcagatggctgg
gataggacttcccaagtttgttcccttggagctctcttgctagattcctattacagaaca
atcaaaggattcatggtcttgatagagaaagactggatctcctttgggcacaagttctct
gacagatgttgtcagttggatggtgatccaaaagagatctcgccagtgttcacccagttt
ttagaaagtgtttggaatctgactgagcagtttccacaagcctttgaatacaatgaagct
ttcctccttcaaatccatgaacacgtccattcgtgccagtttggtaacttccttggaaac
tgtcaaaaagaacgagaagagttaaaactaaaagagaagacgtattccttgtggccattc
cttttgtctgaacagaagaaatatcagaatcctctgtataatccggacttttctccagaa
ctaacacttttggagcctaatacagtatcattcaattttaagttttggagaaatatgtat
catcagtttgatcgaagtatgcatcccaggcaatctgtgttcaacctgatcatgaatacg
agtgaacaaaataaacaactggaggaagacattaaagaactggaagctaaaataaagcag
agaaacgggcggtcagatgtggtccttgtgaaggaacaggagcggacggctgatcctgcc
cccgtggcactgaaatcccctccgtgcttccagaaggagcagccgccgatgccggtgaac
gacgccgtgcgaaccatagagggcagcaacacagcagacaatcgctacagcgaacttgtg
tccgagttctccaaagctgagcctgccgttgtcagcttggagtacggagtggccaggatg
acctgctaa

DBGET integrated database retrieval system