KEGG   Taeniopygia guttata (zebra finch): 100227397Help
Entry
100227397         CDS       T01082                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit alpha-like
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu04010  MAPK signaling pathway
tgu04020  Calcium signaling pathway
tgu04114  Oocyte meiosis
tgu04140  Autophagy - animal
tgu04261  Adrenergic signaling in cardiomyocytes
tgu04270  Vascular smooth muscle contraction
tgu04310  Wnt signaling pathway
tgu04340  Hedgehog signaling pathway
tgu04371  Apelin signaling pathway
tgu04530  Tight junction
tgu04540  Gap junction
tgu04910  Insulin signaling pathway
tgu04912  GnRH signaling pathway
tgu04914  Progesterone-mediated oocyte maturation
tgu04916  Melanogenesis
Module
tgu_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100227397
   04310 Wnt signaling pathway
    100227397
   04340 Hedgehog signaling pathway
    100227397
   04371 Apelin signaling pathway
    100227397
   04020 Calcium signaling pathway
    100227397
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100227397
  Cell growth and death
   04114 Oocyte meiosis
    100227397
  Cellular community - eukaryotes
   04530 Tight junction
    100227397
   04540 Gap junction
    100227397
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100227397
   04912 GnRH signaling pathway
    100227397
   04914 Progesterone-mediated oocyte maturation
    100227397
   04916 Melanogenesis
    100227397
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100227397
   04270 Vascular smooth muscle contraction
    100227397
Enzymes [BR:tgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100227397
Protein kinases [BR:tgu01001]
 Serine/threonine kinases: AGC group
  PKA family
   100227397
Messenger RNA biogenesis [BR:tgu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100227397
Chromosome and associated proteins [BR:tgu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100227397
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like
Motif
Other DBs
NCBI-GeneID: 100227397
NCBI-ProteinID: XP_002197906
Position
Un
AA seq 140 aa AA seqDB search
VTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFAD
QPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLKNGVNDIKNHKWFATTD
WIAIYQRKVRPFLIKTITGL
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
gtcacggactttggctttgcaaaaagagtaaaaggcagaacttggacgttatgtgggact
ccagaatacctggcacctgaaataattctcagcaagggttacaacaaggcagtggattgg
tgggcgctaggagtgttaatctatgaaatggcagctggatatcccccattctttgcagat
cagcccattcaaatttacgagaagattgtgtctggcaaggtgaggttcccatcacacttc
agttcagacctaaaggatcttctaagaaatttactccaggtagatttgaccaaacgatat
ggaaatctcaagaatggtgtaaatgacataaagaatcacaagtggtttgcaactacagat
tggattgccatttatcagagaaaggtaagacccttcctgatcaaaactattacaggtctt
taa

DBGET integrated database retrieval system