KEGG   Taeniopygia guttata (zebra finch): 100227524
Entry
100227524         CDS       T01082                                 

Gene name
ASIC1
Definition
(RefSeq) acid-sensing ion channel 1 isoform X2
  KO
K04829  acid-sensing ion channel 1
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:tgu04040]
    100227524 (ASIC1)
Ion channels [BR:tgu04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   100227524 (ASIC1)
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 100227524
NCBI-ProteinID: XP_030114968
Ensembl: ENSTGUG00000003637
Position
29
AA seq 527 aa
MMDLKVDDEEVDSGQPVSIQAFASSSTLHGLSHIFSYERLSLKRVVWALCFLGSLALLAL
VCTNRIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLN
NRYEIPDIQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQC
TPEDFKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDET
SFEAGIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKAVAGDSEF
YDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYC
ICEMPCNMTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIE
QKKAYEVAGLLGDIGGQMGLFIGASILTVLELFDYAYEVIKHRLCRRGKCRKNHKRNNPD
KGVALSMDDVKRHNPCESIRGHPAGMTYAANILPHHPARGTFEDFTC
NT seq 1584 nt   +upstreamnt  +downstreamnt
atgatggacctgaaagtggacgatgaggaggtggacagcgggcaaccggtgagcatccag
gcctttgccagcagctccaccctgcacgggctctcgcacatcttctcgtacgagcggctg
tcgctgaagcgcgtggtctgggcactttgcttcctgggctcgctggcgctgctcgccctc
gtctgcaccaaccgcatccagtactacttcctgtacccccacgtcaccaagctggacgag
gtggcggccaccaggctcaccttccctgccgtcaccttctgcaacctcaacgagtttcgg
ttcagccgagtgaccaagaatgacctgtaccacgctggcgagctcctggccttgctcaat
aacagatacgagatcccagacatccagacagccgatgagaagcagctggaaatcctgcag
gacaaggccaacttccgaaacttcaagcccaaacctttcaacatgctggagttttatgac
cgggctggccacgacatccgggagatgctgctgtcctgcttcttccgtggggagcaatgc
acccctgaagacttcaaagtggtctttacccgctatgggaagtgctacaccttcaatgcg
gggcaggatgggaagccccggctcataaccatgaaggggggcactggcaacggcctggag
atcatgctggacatccagcaggacgagtacctgccagtgtggggggaaacagatgagacc
tcgttcgaagctgggatcaaggtgcagatccacagccaggacgagcccccgctgatcgac
cagctgggcttcggggtggctcctggcttccagaccttcgtgtcctgccaggagcagcgg
ctcatctacctgccgcctccctggggtgactgcaaggccgtggcgggcgactcggagttc
tacgacacctacagcatcacggcctgccggatcgactgcgagacccgctacctggtggag
aactgcaactgccgcatggtgcacatgccaggcgatgccccttactgcaccccggagcag
tacaaggagtgcgcggacccggccttagatttcctggtggagaaggacaatgaatactgc
atctgtgagatgccctgcaacatgacccgctacggcaaagagctctccatggtcaagatc
cccagcaaggcctcggccaagtacctggccaagaagtacaacaagtcggagcagtacatt
ggggagaacatcctggtgctggatatcttctttgaagccctgaactacgagacgatcgag
cagaagaaagcgtatgaggtggcaggtctgctgggtgacattggagggcagatggggctg
ttcattggggccagcatcctcacagtgctggagctgtttgactacgcctatgaggtgata
aaacaccggctgtgccggcggggcaagtgccgcaagaaccacaagaggaacaacccagac
aagggcgtcgcgctgagcatggacgacgtgaagcgccacaatccctgtgaaagcatacgg
ggacacccagcaggcatgacgtacgcagccaacatcctacctcaccacccggcccggggc
acctttgaggacttcacctgctaa

DBGET integrated database retrieval system