KEGG   Taeniopygia guttata (zebra finch): 100228453Help
Entry
100228453         CDS       T01082                                 

Gene name
PIK3C2B
Definition
(RefSeq) phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta
  KO
K00923  phosphatidylinositol-4-phosphate 3-kinase [EC:2.7.1.154]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu00562  Inositol phosphate metabolism
tgu01100  Metabolic pathways
tgu04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100228453 (PIK3C2B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    100228453 (PIK3C2B)
Enzymes [BR:tgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.154  phosphatidylinositol-4-phosphate 3-kinase
     100228453 (PIK3C2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase PX C2 DUF4135
Motif
Other DBs
NCBI-GeneID: 100228453
NCBI-ProteinID: XP_002187993
Position
26
AA seq 679 aa AA seqDB search
ASCPERVDPTPFPWIPPHSRGSHPTPVDPTPFPRIPPCSHRSIPPHSHDPIPADPTRSPP
QAILREGLEDVAQFFKAHGSCRLPLSPSLLVKGIVPRECSYFNSNAVPLKLSFQNVDPLG
ENIRVIFKCGDDLRQDMLTLQMIRIMNKIWVQEGLDMRMVIFRCFSTGRGRGMVEMIPNA
ETLRKIQVEHGVTGSFKDRPLADWLQKHNPKEDEYEKAVENFIYSCAGCCVATYVLGICD
RHNDNIMLKTTGHMFHIDFGRFLGHAQMFGNIKRDRAPFVFTSDMAYVINGGDKPSSRFH
DFVDLCCQAYNLIRKHTHLFLNLLGLMLSCGIPELSDLEDLKYVYDALRPQDSDADATTY
FTRLIESSLGSVATKLNFFIHNLAQMKFTGSDARPTLSFAPRTHTLKTSGRIRDVFLCRH
ERVFNPSKGYTYVVKVQRDNPGEVTFVQRTFEEFQELHNKLRLLFPSSLLPSFPSRFVIG
RSRGEAVAERRKEELNGYIWHLIHAAPEVAECDLIYTFFHPLPRDEKAAGTNPTPKPADA
TWARSLGKVGGEVKLSISYKNNKLFIMVMHIRGLPPLQDGNDPDPYVKTYLLPDPQKTTK
RKTKVARKTCNPTYNEMLVYDGIPRGDLEQRELRLSVLSEEGFWENILLGEVGIRLRDLD
LAQEKMGWFALGSRGHGTL
NT seq 2041 nt NT seq  +upstreamnt  +downstreamnt
ggcatcgtgccccgagagagtggatcccaccccattcccatggatcccaccccattcccg
cggatcccatcccactcctgtggatcccaccccgttcccgcggatcccaccatgttccca
tcgatcgatcccaccccattcccacgatcccattcccgctgatcccacccgctccccccc
gcaggccatcctgcgcgaggggctggaggacgtggcgcagttcttcaaggcgcacggctc
gtgccggctgccgctcagccccagcctgctggtcaagggcatcgtgccgcgggaatgctc
ctacttcaactccaacgccgtcccgctgaagctctccttccagaacgtggatccgctcgg
ggagaacatccgcgtcatcttcaagtgtggcgatgacctgcggcaggacatgctgacgct
gcagatgatccgcatcatgaacaagatctgggtgcaggaggggctggacatgcgcatggt
catcttccgctgcttctccaccggccgcgggcgaggcatggtggagatgatccccaacgc
cgagaccctgcggaaaatccaggtggagcacggcgtgaccggctccttcaaggaccggcc
gctggcagactggctgcagaaacacaaccccaaggaggacgagtacgagaaggccgtgga
aaacttcatctactcctgtgccggctgctgcgtggccacctacgtgctgggcatctgcga
caggcacaacgacaacatcatgctcaagaccacgggccacatgttccacatcgatttcgg
caggttcctgggccacgcccagatgttcggcaacatcaagagggaccgggcgccgttcgt
cttcacctcggacatggcgtacgtcatcaacggcggggacaaaccctccagccgcttcca
cgacttcgtggacctgtgctgccaggcctacaacctgatccgcaagcacacccacctctt
cctcaacctgctggggctgatgctctcctgtggcatccccgagctctccgacctggagga
cctcaagtacgtctacgacgcgctgaggccgcaggactccgatgccgacgccaccaccta
cttcaccaggttgatcgagtccagcctgggcagcgtggccaccaagctcaacttcttcat
ccacaacctggcgcagatgaagttcacgggctcggacgcccggcccacgctgtccttcgc
gccgcgcacgcacaccctcaaaacgtccggccggatccgcgacgtcttcctctgccgcca
cgagagggtcttcaaccccagcaagggctacacctacgtggtgaaggtgcagagggacaa
ccctggcgaggtcaccttcgtgcagcgcaccttcgaggaattccaggagctgcacaacaa
actgcgcctcctcttcccctcctcgctgctgcccagcttccccagcaggttcgtcatcgg
gcgctcgcggggcgaggcggtggccgagcggcgcaaggaggagctcaatggctacatctg
gcacctgatccacgccgcccccgaggtggcagagtgtgacctcatctacaccttcttcca
ccccctgccccgggatgaaaaggcggctggaaccaacccgaccccaaagccggcagatgc
cacgtgggctcgatccctgggcaaggtcggcggggaggtgaaactctccatctcctacaa
gaacaacaagctcttcatcatggtgatgcacatccgagggctgccacccctgcaggacgg
caacgaccccgacccctacgtcaaaacctacctgctgcccgacccccaaaaaaccaccaa
gaggaaaaccaaagtggcccgaaaaacctgcaaccccacctacaacgagatgctggtgta
cgacgggatcccccgcggggacctggagcagcgggagctgcggctgagcgtgctgagcga
ggaaggattttgggagaatatcctgctgggggaggtgggaattcgcctccgcgacctgga
cctggcccaggagaagatgggctggttcgccctgggctcccgcggccacggcaccctctg
a

DBGET integrated database retrieval system