KEGG   Taeniopygia guttata (zebra finch): 100228506
Entry
100228506         CDS       T01082                                 

Gene name
AFF3
Definition
(RefSeq) AF4/FMR2 family member 3 isoform X1
  KO
K15195  AF4/FMR2 family member 3
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:tgu03021]
    100228506 (AFF3)
Transcription machinery [BR:tgu03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     100228506 (AFF3)
SSDB
Motif
Pfam: AF-4 AF-4_C AF4_int
Other DBs
NCBI-GeneID: 100228506
NCBI-ProteinID: XP_030134346
Position
1
AA seq 1254 aa
MDSFDLALLQEWDLDSLCVYEPDRNVLRRKEWERRNQEAQQDNGAFNMSYSLFSEPYKTN
KGDELSNRIQNTLGNYDEMKDLLTDRSNQSHLVGVPKPGVPQTPLPKTDEHHIADSRPPP
PPPISSTTSSTPASLAAQQSKSTTMGWQKSGHNASSDGQQRASKHGHRSLESHKGDFKLA
SQKSNLEKLKHYALSPTSSSSSSSTSSSSSTTSSSSSSSSSNTAQQSSLRATLGDNTNRV
QQPAKLSCSSEGGTKVQERPAKHGGGHCVQNFPPSLASKPSLGQQKPTAYVRPMDGQDQA
PDESPKLKLPAETTKSYRGVPSSKPDSARTKSKITKFSIPKQEEDSGTGDNSCIEEILRE
MTHSWPPPLSAIHTPGKAEQSKFPFPNKESQQGSTGHSNTRKSDVEPKTPEKSATHTSML
EDDLKLSSDEEENDQQAAQRSALRVLSDSLVVPQSNARAPGLSSKGSSSSSSSESETSSE
SDSESESSSSESDGSKPSHYSSPEPEPPSSNKWQLDKWLNKVTPHKAPILAHHDGPALEA
HPYYGRVKAERQEGQKTPAEGPAEHRSEESRTAANAAAAAAGDGPRPRTASKAPGSKGSR
QKSPLAADGGPPRRAAGKKAPRRAERNSGGDGPPCPSAEELPRSHGFPDSAAGEAPRARP
AGGGCRAGHRREPRSAAAGEKRRARGPSKTAPKSKEFIETESSSSSSSSDSGSESEREEC
PLPKAPAAAGPEPRGAKDAGTGTASKPHGGCSAFGSINARTSSEIAKELEEQFYTLVPFG
RNELLSPLKDSDEVKSLWVNIDLALLSRIPERLPEEPLAMSAGANQAASSPQGSSAEPPA
EKGLPKSRRKRKCENEEECRDNKKTHLERESSSRLAASAQSVTTANHCNINENSLAIPIN
KNEKMLRSPVSPLSDASKHKYSNDDLTSSSRPNGSSLLPSISSSKKHKGEIQSQPHPGDL
NKAIHINSENILLCNKPQFQTEPWPPLSTTPRDCRRTKLIFDDIPRNADYFMQEAKRKKH
KADAMVEKFGKALNYAEAALSFIECGNAMEQGPMESKSPYTMYSETVELIRYAVRLKTHS
GPNATPEDKQLAALCYRCLALLYWRMFRLKRDHAVKYSKALIEYFKNSSKAHQNPSPWGA
SGKSTGTPSPMSPSPSPVSSVGSQGSTGAPSPSPIITIPQRIHQMAANHVSITNSILHSY
DYWEMAENLAKENRDFFNDLDALMGPITLHSSMEHLVQYTQQGLHWVRNSAHLS
NT seq 3765 nt   +upstreamnt  +downstreamnt
atggacagcttcgacttagctctccttcaggagtgggacctggactctctatgtgtctat
gagccagatagaaacgtgctgcgaaggaaggaatgggaaaggagaaatcaggaggcccag
caggacaatggcgcatttaacatgagctattccctcttcagtgaaccgtacaagactaac
aagggggatgagctttccaatcgcatccagaatactttgggcaactatgatgaaatgaaa
gacttgttaactgaccggtcaaaccagagccatctcgttggggttccgaaaccgggggtt
cctcagacacctctccccaagactgatgagcatcatatcgcagactcgagaccaccacct
cctcctcctatttccagcactacttcttcaacaccagcatccctagctgcccagcagagc
aaaagtaccacaatgggctggcagaagtctgggcataatgccagttcagatggccagcag
agagcaagcaaacacggacaccggtcgctggagtcacacaagggtgacttcaaactggcg
agccaaaaatccaatttggagaaactaaaacactatgcattgagtcccacctcctcctct
tcctcctcctccacctcctcttcctcctccaccacttcctcctcctcctcctcctcctcc
tccaatactgcccagcaaagttcactgagggccacattaggagacaacaccaatagagtc
cagcagccagcaaagctcagctgtagctcagaaggaggaaccaaagtccaagagaggcca
gcaaagcatggtggggggcactgcgtccaaaacttcccaccttctcttgcttcaaagccc
agtctgggtcagcagaagccaacagcttatgtaaggccaatggatggtcaagaccaggct
cctgatgagtctccaaagctgaagttaccggcagagacgaccaagtcatatcggggagtg
ccttccagcaagcctgattcggctaggaccaagtcaaagatcaccaagttcagcattcct
aagcaagaagaagacagtggaacaggagataacagctgcattgaagaaatattgcgggag
atgacgcattcatggcctccgccactgtcagctattcacacaccaggaaaggcagaacaa
agcaagtttcccttcccaaacaaggagtcacaacagggatctacaggacacagcaataca
aggaaaagtgatgtagagccaaagaccccagagaaaagcgcaacccatacatcaatgcta
gaagatgacctcaagttaagcagtgatgaagaggagaatgaccagcaggcagcacagaga
tctgctctccgcgttctatctgacagcctggtggtgccgcagtccaatgcccgagccccg
ggactctccagcaaggggtcgagcagcagcagctccagtgaatccgagaccagctcagag
tctgactcagagagcgaaagcagctctagcgagagtgacggcagcaagccctcgcattac
tccagcccagagcctgagccgccctcgtccaacaagtggcagctggacaagtggctgaac
aaagttacccctcacaaagcacccatcctagcccaccacgatggcccggcgctggaagcc
catccctactacggccgggtgaaggcagagcggcaggaaggacagaagaccccggctgag
ggcccggccgagcaccgcagtgaggagagccgcaccgccgccaacgccgccgccgctgcc
gccggggacgggccgcggcccaggaccgccagcaaagcgccgggcagcaagggcagccgg
cagaagtcacccctcgctgccgacggcgggccgccgaggcgggcagcagggaagaaggca
ccgcggcgcgccgagaggaactcgggcggagacgggccgccctgccccagcgcagaggag
ctgccccggagccacggcttccctgacagcgctgccggcgaggcgcccagggcccggccc
gccggcggcggctgcagagcggggcaccgccgggagccccgctcagccgcagctggtgag
aagcgtcgggcccgagggccgagcaaaacggcgcccaaatccaaggagttcatcgagacc
gagtcttcgtcctcatcatcctcctccgactcaggctctgagtcggagcgggaggagtgc
ccgctgcccaaggcgccagcggcagccgggcctgagccgcggggtgccaaggacgcgggg
accggcaccgccagcaaaccccacggcggctgcagtgcctttggctctattaatgccagg
actagtagtgaaatagcaaaggagctggaggaacagttttacaccctggttcctttcggt
aggaatgagctcctgtctcctctgaaagacagtgatgaggtaaagtcgctgtgggtcaac
attgacttggctcttttgtccaggattccagagcgtttgcccgaagaaccgctggccatg
agcgccggagcaaaccaggcggccagctccccgcagggtagtagtgctgaaccccccgca
gagaagggtttaccgaaatctagaaggaaacgcaagtgtgagaatgaggaagagtgcaga
gacaacaagaagactcacttagagcgggagagttcttcacgtttagctgcctctgcccaa
agcgtcacaacagcaaatcactgcaatataaatgaaaatagcttggcaataccaataaat
aaaaatgagaaaatgcttcggtcacccgtctctcccctctctgatgcatcaaaacacaaa
tattccaacgatgatttaacttcctccagcagacctaatggcagcagtctattaccttca
atctcctccagcaaaaaacataagggtgaaatccagtcacagccacatcctggggacctc
aataaagcaattcacatcaattcagaaaatattcttctctgcaataagccacagttccaa
acagagccttggccacctctatccaccacacccagggactgcagaagaacaaagcttatc
tttgatgatataccacgcaatgcagattactttatgcaggaagctaaacggaagaagcat
aaagcagatgcaatggtggagaagtttggaaaggcactgaattatgcagaagcagcacta
tcatttattgagtgtggaaatgcaatggaacaaggcccaatggaatctaaatccccttat
accatgtattcagaaacagttgaactcatcaggtatgcagtgagactaaaaacccactca
ggccccaacgccacgccagaagacaaacagctggcagcattatgttaccgctgcctggcc
cttctgtactggaggatgttccgactcaagagagaccacgcggtcaagtattcaaaagcg
cttattgagtatttcaagaattcatcaaaagctcaccagaatccgtctccttggggtgcc
agtggaaagagcacaggaactccatcaccaatgtcccctagcccttctccagtcagttct
gtaggatcccaggggagcacgggggccccttccccatctcctatcatcaccatcccacag
cgcattcatcagatggccgccaaccacgtcagcatcaccaacagcatcctgcacagctat
gactactgggagatggctgaaaacctggccaaggaaaacagagatttttttaacgacttg
gatgcattgatgggacctattaccttgcacagcagtatggagcatttagttcagtacact
caacaaggacttcactgggtgcggaatagtgctcacttgtcataa

DBGET integrated database retrieval system