KEGG   Taeniopygia guttata (zebra finch): 100228883
Entry
100228883         CDS       T01082                                 

Gene name
NOX3
Definition
(RefSeq) NADPH oxidase 3
  KO
K21422  NADPH oxidase 3 [EC:1.6.3.-]
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tgu04131]
    100228883 (NOX3)
Enzymes [BR:tgu01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.3  With oxygen as acceptor
    1.6.3.-  
     100228883 (NOX3)
Membrane trafficking [BR:tgu04131]
 Others
  NADPH oxidases (Nox) and associated proteins
   NADPH oxidases
    100228883 (NOX3)
SSDB
Motif
Pfam: NAD_binding_6 Ferric_reduct FAD_binding_8 FAD_binding_6 PDGLE
Other DBs
NCBI-GeneID: 100228883
NCBI-ProteinID: XP_030123921
Ensembl: ENSTGUG00000011124
Position
3
AA seq 553 aa
MLVWLGLNFYLFIDTFHWYEDDNAYIYTRIMLGSTLAWARASATCLNFNCMLILLPVCRN
LISFLRGASIHCGGALRRQLDKNITFHKMVAYGIALNATIHIVAHSINIERYHSSQSKEA
GELRNKLSGLGKSPNESYLNPIRTYETSTTGQLLTTIAGITGVVITVALILIMTSSTELI
RRSCYEVFWYTHHLFVVFFTGLIIHGMGQLVRGQTPQSLLLHNVTYCKDHYWEWENATQC
PLPEFSGNKPVAWKWLLSPMLLYICERIVRFWRFQQEVVITKVVTHSSGVLELHMKKHGF
KMGAGQYIFLQCPSVSQLEWHPFTLTSAPEEDYFSVHIRLVGDWTAALFKAFGAEEKSLK
ELWMLPRLAVDGPYGSATTDIFHYQVSVCIAAGIGVTPFASILKSIWYKCCNPNTVLALQ
KVYFYWICRDPSAFEWFADLLFHLETKMGEKWKNDFLSYHIFLTGWDESQATHIALHCDD
KMDVITGLRQKTCYGRPNWDNEFKQLAENHPSNSIGVFFCGPKALSKILQKICHSYSSVD
PRGVQFHYNKESF
NT seq 1662 nt   +upstreamnt  +downstreamnt
atgctggtgtggctgggactgaacttctatttgtttattgataccttccactggtatgaa
gatgacaacgcttacatttatacacggattatgctgggatcaaccctggcttgggcaaga
gcttctgcaacgtgccttaattttaactgcatgctaatcctgttaccagtttgtagaaac
cttatttcattcttaagaggagcaagcattcactgtggaggagcattgaggagacagctt
gacaaaaacatcacatttcacaagatggttgcctatggaatagcgttaaatgcaaccatc
catattgttgcccactccatcaacatcgagcggtatcattccagccagtcaaaagaagct
ggcgagttacggaataaactttctggtcttggcaagagcccaaatgaaagctacttgaac
ccaatcaggacctatgaaacaagcacaacaggacaattactaaccacaatagctggaata
actggagttgtgataacggtggctttaattctgatcatgacttcgtccactgagctcatc
agaaggtcatgctatgaggttttctggtacacccaccacctctttgtggttttcttcact
ggtttaataatccatggtatgggtcagcttgtccgaggtcagacaccccagagtctgctg
cttcacaatgtcacctactgcaaagatcactactgggaatgggagaacgccactcagtgc
cctttgccagagttttctggcaacaaacctgtggcttggaagtggcttttaagtcctatg
ctattgtacatctgtgaaagaattgttaggttttggagatttcaacaggaagttgtcatt
actaaggtggtgacacattcctctggagtccttgagctccacatgaagaaacatggcttt
aaaatgggagctggccaatatatatttctacagtgcccatctgtctcacagctggagtgg
caccctttcaccctcacctcagctcctgaggaggactacttcagcgtccacatacggctc
gttggggattggactgcagcccttttcaaggcctttggagcagaagaaaaatctttgaag
gaattgtggatgttaccaagactggctgtggatggaccatatggatctgcaaccacagac
atcttccactaccaagtcagtgtgtgcattgcagcaggaattggagtcacaccatttgcc
tctattttaaaatccatttggtacaaatgctgcaaccctaacacagtactggcactgcag
aaggtttatttttactggatttgtcgagacccatcagcatttgagtggtttgctgatctt
ctgttccatttggaaacaaaaatgggtgaaaaatggaaaaatgattttctaagctatcat
atatttcttactggctgggatgaaagtcaggctactcacatagccctacattgtgatgac
aagatggatgtaattactggtttgagacagaaaacctgttatggaaggccaaactgggac
aatgagttcaagcaactagctgaaaaccatcctagcaacagcattggtgtattcttctgt
ggacccaaggcgctctctaagatcctgcagaagatatgccactcatactcatcagttgat
ccaagaggagttcagtttcactacaacaaagaaagtttctag

DBGET integrated database retrieval system