KEGG   Taeniopygia guttata (zebra finch): 100229078
Entry
100229078         CDS       T01082                                 

Symbol
IFI30
Name
(RefSeq) gamma-interferon-inducible lysosomal thiol reductase
  KO
K08059  interferon, gamma-inducible protein 30
Organism
tgu  Taeniopygia guttata (zebra finch)
SSDB
Motif
Pfam: GILT
Other DBs
NCBI-GeneID: 100229078
NCBI-ProteinID: XP_030112511
Position
28:2138513..2140361
AA seq 252 aa
MAPAVPPALLALLALLAPALGCDRPAHRWCSSRDVAAACQVESRCPSLPHPAAAPVELSL
YYESLCPACREFLVLKLFPTWLLLPEEMLNITLVPYGNAQERNVSGKLDFQCQHGPEECL
GNMMEACLMHEAKNFSTYFPVIFCLEAGSSVTKNLEACLQIYAPEVDSGRISACVQGDTG
VALMHHNAQVTEALHPPHQYVPWITVNGKHTDELQAQAEASLLGLVCQLYQGEKPEVCGG
SKATKIPSGCRR
NT seq 759 nt   +upstreamnt  +downstreamnt
atggcccccgcggtgccgccggccctgctggccctgctggccctgctggccccggcgctg
ggctgtgaccgccctgcccaccgctggtgcagctcgcgggacgtcgctgccgcctgccag
gtggagagccgctgccccagcctcccgcaccccgcggccgcgcccgtggagctgagcctg
tactacgagagcctgtgcccggcctgccgcgagttcctggtgctgaagctcttccccacc
tggctgctgctgcccgaagagatgctgaacatcaccctggtgccctacggcaacgcccag
gagaggaacgtcagcgggaagttggacttccagtgccagcacggccccgaggaatgcttg
ggcaacatgatggaggcctgtctgatgcacgaggccaagaacttcagcacctacttcccc
gtcatcttctgcctggaggcgggcagctccgtcaccaagaacctggaggcttgcctgcag
atctacgccccagaggtggacagcggccgcatcagcgcctgcgtgcagggggacacgggg
gtggccctgatgcaccacaacgcccaagtgaccgaggcgctgcaccccccgcaccagtac
gtgccctggatcaccgtcaatgggaagcacacggacgagctgcaggcacaggcagaggcc
tcgctgctggggctggtttgccagctctaccagggggagaagcctgaagtctgtgggggc
tccaaggccacgaagatcccgtctggctgcaggcgctga

DBGET integrated database retrieval system