KEGG   Taeniopygia guttata (zebra finch): 100229153
Entry
100229153         CDS       T01082                                 
Symbol
CPB2
Name
(RefSeq) carboxypeptidase B2 isoform X1
  KO
K01300  carboxypeptidase B2 [EC:3.4.17.20]
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:tgu01002]
    100229153 (CPB2)
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.20  carboxypeptidase U
     100229153 (CPB2)
Peptidases and inhibitors [BR:tgu01002]
 Metallo peptidases
  Family M14: carboxypeptidase A family
   100229153 (CPB2)
SSDB
Motif
Pfam: Peptidase_M14 Propep_M14 DUF1642
Other DBs
NCBI-GeneID: 100229153
NCBI-ProteinID: XP_030128242
Ensembl: ENSTGUG00000012294
Position
1:complement(58412311..58425416)
AA seq 424 aa
MKMKFYLLFFTFFILVPEKYVFTIPRDEVLWALPQTDEQVEALQDLLNTTEVILWQPVVV
ENIQKGREVHFYVRASNINSIKAQLRQLTIQQKVLLGDVQGIIEKQTANDTVNARGSSSY
YENYHSMKEIYHWMEAVVQVHSDLLQKIYIGSSYEKRPLYVLKISKSKEKSKNAIWIDCG
IHAREWISPAFCLWFTGHAIHVRERDRTMTRLLEHFDFYIMPVINVDGYEYTWSHPSNRL
WRKSRSSHGNSKCIGTDMNRNFDAHWCGPGASHSECQEIYCGPYPESEPEVKAVARFVRD
HKDTIKAYITMHSYSQLVLFPYSYTMNKSKDHEELESLAQKAAKAIKRTTWKTYRSGAGA
QTIYLAPGGSDDWAYDLGIKYSFTFELRDTGTYGFLLPPREIKPTCLEALSAVKEIAQHI
LQNL
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgaagatgaagttttacttgctctttttcaccttttttatcttggttccagagaagtat
gtcttcactattccaagggatgaagttttgtgggctctcccacaaaccgatgaacaagtt
gaagctcttcaggatttactgaacaccactgaggtcattctctggcaaccggttgtggtt
gaaaacatccagaagggcagagaagtccatttctatgtcagggcatccaacataaatagc
ataaaagctcagttaaggcaactgaccatccaacaaaaagtcttgctgggagatgttcaa
ggaattattgaaaaacagactgccaatgacacagtcaatgctcgtggatcttcctcatac
tatgaaaactaccattcaatgaaagaaatatatcattggatggaagcagtagtgcaagtc
cactctgatctcctccagaaaatatatattggatcatcctatgaaaagcggccgctttat
gttctgaagatttctaaaagcaaggaaaaatcaaaaaatgccatatggattgactgtggt
atccacgctagagaatggatttctcctgctttttgcctgtggttcacaggtcatgcaatc
catgtgcgtgagagagatcggaccatgacaagacttctggagcactttgatttctacatc
atgcctgtgataaacgtggatggctatgaatacacatggagccacccctctaatcggctg
tggagaaaaagccgctcctcgcacggtaacagcaagtgcattggtactgacatgaacagg
aattttgatgcacactggtgtggtccaggagcatctcactctgaatgccaggagatatac
tgcggaccctacccggaatctgagcctgaagtaaaagcagtggctcgctttgtcagagac
cacaaggacaccattaaagcctacataaccatgcactcctactcccagttggtgttgttt
ccatattcttacactatgaacaaaagcaaggaccatgaagagctggaaagtctggcacag
aaagcagctaaagctataaagaggacaacttggaaaacttacagatctggtgctggtgca
caaacaatctatttagctcctggaggatcggacgactgggcttatgatcttggcattaaa
tattcttttacctttgagcttcgtgacacaggaacttacggatttttgcttcctcctcga
gaaatcaagccaacttgcttagaagcactttctgctgtcaaagagatagctcaacacatt
ctgcaaaatttgtga

DBGET integrated database retrieval system