KEGG   Taeniopygia guttata (zebra finch): 100229215Help
Entry
100229215         CDS       T01082                                 

Gene name
DBT
Definition
(RefSeq) lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial isoform X2
  KO
K09699  2-oxoisovalerate dehydrogenase E2 component (dihydrolipoyl transacylase) [EC:2.3.1.168]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu00280  Valine, leucine and isoleucine degradation
tgu00640  Propanoate metabolism
tgu01100  Metabolic pathways
Module
tgu_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    100229215 (DBT)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100229215 (DBT)
Enzymes [BR:tgu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.168  dihydrolipoyllysine-residue (2-methylpropanoyl)transferase
     100229215 (DBT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-GeneID: 100229215
NCBI-ProteinID: XP_002188172
Ensembl: ENSTGUG00000005200
Position
8
AA seq 493 aa AA seqDB search
MAAVTALRSSCRAAGRLVCIHRVRSCSSIRFIKSKYVCVFDKSALKFSHQQRLFRTSAVS
CGQIVQFKLSDIGEGITEVTVKEWYIKEGDSVSQFDSICEVQSDKASVTITSRYDGVIRK
LHYSIDDTAFVGKPLVDIEIDASKGVASEEDVVETPPMSHEEHTHQEIKGHKTLATPAVR
RLAMENNIKLSEVVGTGKDNRILKEDILNYLAKQTGAILPLSPKAEIVPPQRKAEAVPAA
PKDKARKIPVPVSRPLAFSEKDKTEPVTGFQKAMVKTMSAALKIPHFGYSDEIDLTQLVQ
LREELKPLAEIRGVKLSFMPFFIKAASLGLLQYPILNASLDENCQNVTYKASHNIGVAMD
TEQGLIVPNVKNVQVCSVFDIAVELNRLQSLGSAGQLGTSDLTGGTFTLSNIGTIGGTYA
KPVILPPEVAIGALGKIQVLPRFNSKGEVIKAQIMNVSWSADHRIIDGATMARFSNLWKS
YLENPALMLLDLK
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgtgaccgcgctgaggagcagctgccgagccgcggggcgcctggtttgcatt
catcgcgttagatcgtgcagcagcattcgctttataaaatcaaaatatgtgtgcgtgttt
gacaaatctgccctcaagtttagtcatcaacagcgattattcagaacatctgctgtttca
tgtggccaaattgtccagtttaagctttctgacattggagaaggaattacagaggtgact
gtaaaagaatggtacataaaggaaggtgacagcgtatctcagttcgacagcatctgtgag
gtgcagagtgataaagcctctgttactatcaccagtcgttatgatggtgtcatcagaaaa
ctccattacagcatagatgatactgcttttgttggaaaaccactagtggacattgaaatt
gatgcttcaaaaggtgttgcctcagaagaagatgttgttgaaacacctcctatgtctcat
gaagagcacactcaccaagagataaaaggtcacaaaacattagcaacccctgcagttcgt
cgcctggccatggagaacaatattaaattgagtgaagtcgttgggacaggaaaggataat
agaatccttaaagaagatatactcaactacttggccaaacaaacaggagctattttgcct
ctatcaccgaaggctgaaattgtcccacctcagcggaaagcagaggctgtgccagctgct
ccaaaggacaaagcacgcaaaattcccgtgcctgtttccagaccccttgcattttcagaa
aaagataaaacggaacctgtaacaggttttcagaaggccatggtaaaaactatgagtgca
gccctaaagatcccccactttggttattctgatgagattgatttgactcaacttgttcag
ctgcgagaagagctgaaacctcttgctgaaatccgtggagttaagctttcctttatgcct
ttcttcataaaggcagcctctctgggattgctgcagtatcccattcttaatgcttctttg
gatgagaactgtcaaaatgtcacatataaggcttcacacaacattggagttgcaatggac
acagagcaaggtttaattgtcccaaatgtgaaaaatgttcaagtctgcagtgtgtttgac
attgctgtggaattaaatcgcctccagtccttgggctctgcaggccaactgggaacaagt
gacctcactgggggaacattcaccctttcaaatattggcacaattggtggcacttatgcc
aaaccagtgatactacctcctgaagtagctattggagcacttggaaagatacaggttctt
cctcggtttaatagcaaaggtgaagtaattaaagcacaaataatgaatgtgagttggtca
gctgatcatcgcatcattgatggagctacaatggcccggttttctaacttgtggaaatct
tacttggagaaccctgctttgatgctgctggaccttaaataa

DBGET integrated database retrieval system