KEGG   Taeniopygia guttata (zebra finch): 100229594Help
Entry
100229594         CDS       T01082                                 

Definition
(RefSeq) cytosolic phospholipase A2 beta
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu00564  Glycerophospholipid metabolism
tgu00565  Ether lipid metabolism
tgu00590  Arachidonic acid metabolism
tgu00591  Linoleic acid metabolism
tgu00592  alpha-Linolenic acid metabolism
tgu01100  Metabolic pathways
tgu04010  MAPK signaling pathway
tgu04217  Necroptosis
tgu04270  Vascular smooth muscle contraction
tgu04370  VEGF signaling pathway
tgu04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100229594
   00565 Ether lipid metabolism
    100229594
   00590 Arachidonic acid metabolism
    100229594
   00591 Linoleic acid metabolism
    100229594
   00592 alpha-Linolenic acid metabolism
    100229594
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100229594
   04370 VEGF signaling pathway
    100229594
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100229594
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    100229594
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100229594
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100229594
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: cPLA2_C2 PLA2_B C2
Motif
Other DBs
NCBI-GeneID: 100229594
NCBI-ProteinID: XP_030130205
Position
5
AA seq 872 aa AA seqDB search
MGSPPAKMKFCPIHMLSVRIIQAKNIKSKDLWTVPLSCQNLAGQCYSLLDTSLKYLGISG
CSRNLPSSPDSSSERHHPGDFLSHRCQASQMTASDCYVRLWLPSASPGKLQTKTIKNSDN
PVWNETFYFRIQREVENILELAVCDEDALTKDDMQFTVLFNVARIRPGEMIRETFALKSE
TESCRKKWESLEVEFWMERIPGPPEHLITNDVLVSREVCCLEVHVDINESRKYLKEGKNL
VLTVPASHERTQKTTEDTDTFYFHCVKAWEPVLKVRLQKVSDKEDDNSNLSDTLTIPLKY
LPVGHKVKVTLPVRHNVPLQLYLQLNACTEKLDVRLGYDLCQGEQEFLHKRRRVVAGALK
RVLHLERDLHGHEVPVIAVMATGGGLRAMSAMFGHLLALQKLNLLDCVTYLTGASGSTWT
LADLYEHADWSQKSLEGPLKAVKEQVTKCKLNLMSIDHLKYYHKELAERAKAGHVPSFTT
LWSLVQEMFLHERPRKYKLTDQRKALEHGQNPLPFYAVLNVKEEKFGTFKFREWADFSPY
EVAIPKYGVSIPSEYFDSEFFMGRRVKKLPESRICYLEGLWTNIFTRNLLDGLYWSSNSN
EFWERWSQDMVDIEKHSPEEDITVIEPPSCLSGKLYEIFQDIMTKRPLLGKSHNFLRGLE
FHKDYIHQKKFIEWKDTVLDGFPNSLTPLQKYLCLIDVGYFINTSGAALFKPERNVDVII
SLDYGLGNVFKQLEMTYKYCKIQNIPFPKVELSPEEEKNPKECYIFADAEDPRAPIVIHF
PLVNDTFKEFKEPGVKRGHSEMEEGKVNLENNCSPYYLIRLIYSSENFDKLVNLSKYNIL
NNKDLLLQAIRSAVERRRSRRTGNFSSYSGYP
NT seq 2619 nt NT seq  +upstreamnt  +downstreamnt
atggggagcccaccagccaagatgaagttttgccccatccacatgctttctgtaagaatc
atacaagctaagaacatcaagtcaaaagacctgtggacagttccactttcgtgccaaaac
cttgcggggcaatgttattcactgcttgataccagtctgaagtatttaggcatctcgggc
tgcagtagaaatcttccatcaagtcctgactccagctctgaaagacatcaccctggagat
ttcctttcacaccgttgccaagcttcacaaatgactgcgtcagactgctatgtacgcttg
tggctgccgtctgcttcacctgggaagcttcagaccaaaactatcaagaattctgacaac
cctgtctggaacgagactttctactttaggatccagagagaagttgagaacattttagaa
ttggcagtgtgtgatgaagatgcactcaccaaagatgacatgcagttcacagttcttttt
aatgttgctagaatcagacctggggagatgatccgcgagacctttgctttgaaatcagag
acagagagttgccgtaagaaatgggaaagtttggaagtggaattctggatggaaagaatt
cctggccctccagagcatctcattaccaatgatgtcctagtgtcccgtgaggtttgctgc
ttggaagtgcatgtggacattaatgaaagcaggaaatacttgaaagagggtaaaaatctc
gtgcttacggtgcctgcatctcatgagagaacgcagaagacgacagaggacaccgatact
ttctacttccactgtgtgaaggcttgggagccagttctgaaagtcaggctgcagaaagtt
tctgataaggaagatgacaacagcaatttaagtgacaccttaacgataccactgaaatat
ctccctgttggacataaagtgaaagtaacccttcccgtaagacataatgtgccgctacag
ttgtacctccagctaaatgcttgcacagaaaaactagatgtgcgcttagggtatgatctg
tgccaaggagagcaagagttcctgcataagaggaggagagtcgttgctggtgccctgaaa
agggttcttcatctggaaagagatctacatggacatgaggtcccagtaatagctgtaatg
gcaacaggcggaggtctcagagcgatgtcagctatgtttggccacctcttagctcttcag
aagctaaatctcttggactgtgtcacctacctcactggggcttctggctcaacatggacc
ctagcagacctgtatgagcatgctgactggtcacagaagtctctggaggggccactaaaa
gcagtaaaagagcaagtgacaaaatgcaaactcaaccttatgtctatagaccatctgaaa
tattatcacaaggaacttgctgaaagggcaaaagcaggacatgtgccatcttttacaact
ctgtggtcacttgttcaggagatgttcttacatgaacggccaagaaagtacaaactcaca
gaccagcgcaaggcattggagcatgggcaaaacccactgcctttctatgcagtcctcaat
gtgaaagaggagaagtttggtactttcaaatttagagagtgggcagatttctctccttat
gaagtggccataccaaaatatggagtctccattccttcagaatattttgacagcgagttc
ttcatgggaaggagagtgaagaagctgccagagtctcggatctgctatctggaaggtctt
tggacaaacatctttactaggaatttgctggatggcttgtactggtcctcaaattcaaat
gaattctgggaacgatggtcccaagatatggtagatatagaaaagcattctcctgaggaa
gacattactgttatcgagcctccatcttgtttgtcaggaaagttgtatgaaatatttcag
gacattatgaccaagcgtccactactgggaaagtcacataacttcctgagaggcttagag
tttcataaggattatatccatcagaaaaaatttattgaatggaaagacactgtgctggac
ggtttccctaacagtctgacaccactgcagaaatatctttgtctgatagatgttggctat
ttcatcaacaccagcggtgcagcacttttcaagccagagaggaatgtagatgtcattata
tcccttgattatggtttgggaaatgtgttcaagcaattagagatgacatacaaatattgc
aagatacagaatatcccattccccaaagtggagctaagtccagaagaggagaagaaccca
aaagaatgttacatatttgcggatgcagaggatcccagagcacctatagtaatccatttt
cccttggtgaatgacacctttaaggaattcaaggagccaggggtgaagcgtggtcactcg
gagatggaagaaggcaaagtaaatctagagaacaactgctcaccatactacctcattagg
ctaatttactcctctgaaaactttgacaaacttgtaaacctgagcaaatacaacatcctc
aataacaaagacctgctcctccaggcgatcaggagtgctgtagaacgaaggagaagcaga
aggactgggaatttctccagctactctggatacccctaa

DBGET integrated database retrieval system