KEGG   Taeniopygia guttata (zebra finch): 100230229
Entry
100230229         CDS       T01082                                 
Symbol
MPDZ
Name
(RefSeq) multiple PDZ domain protein isoform X1
  KO
K06095  multiple PDZ domain protein
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu04530  Tight junction
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100230229 (MPDZ)
SSDB
Motif
Pfam: PDZ PDZ_6 PDZ_2 Peptidase_M50 L27_2 MPDZ_u10 L27_1
Other DBs
NCBI-GeneID: 100230229
NCBI-ProteinID: XP_012433199
Position
Z:complement(70406519..70500503)
AA seq 2143 aa
MLETIDMHRALQAMERLQAKLRDRGDIANEEKLSLLKSVLQSPLFNQILSLQTSVQQLRD
QVNITPSIHSSGEFPQLLHHGVNVGSLPLNESYLLAQPNGNPANVLETSMRSITPQINGK
FCSEDFEQLIRNMSQGRLVETIDLIKPLSGGLGFSVVGLKSENRGELGIFVQEIQEGSVA
HRDGKLKEADQILAINGQALDQTITHQQAISILQKAKDNVQLVVARGTFPQLISPVVSRS
PSAASTVSAHSNPVHWQHVETIELVNDGSGLGFGIVGGKSTGVIVKTILPGGVADQHGRL
CSGDHILKIGDTDLAGMSSEQVAQVLRQCGNRVKLVIARGPVEEPLLPAVPPGTPVPTST
PEKQDDASVDSCEDGEKFNVELTKNNQGLGITIAGYIGDKTSEPSGIFVKSITKGSAVEH
DGRIHVGDQIIVVDGTNLQGFTNQQAVDVLRHTGQTVRLTLIRRGRKQENCIPPQEDFSA
PVEQDLLFQTRDSTTAKDNNETEQGSPSLPCSASVVNIGDDMKQQETGSQDFQLTSTEEA
AAKIKWQRIMGSNYEIVVAVVNKFSESSGLGISLEATVGHHFIRSILPEGPVGRSGKLFS
GDELLEVNEISLLGENHKDVVSILKELPIKVTMVCCRPVAPPVTQPEILESLSLSEVQLT
EKGHIELGFVGSSDTEGTPLETADEGQSMEEVQSSSLAMWETEVQHIELEKGSMGLGFSI
LDYQDPVDPANTVIVIRSLVPGGVAEQDGRLLPGDRLMFVNDINLENGSLEEAVQALKGA
PTGKVKIGVAKPLPLSPEEGYVSAKEDCFFYTAQSLEEEGPADAALFRAELALVDSGEAD
LADESTFEAQYSLERDVFQDSVAALHDGACSSEVHDSFSLPLSIPKSLGEECPNAAPDFR
VSEKNLYNMNLNQRLRDEKSVADSSLETASDFTKIDLLTLEVSDTNQNENIATWTGSQTT
SEIVLNTSLATTTQLDPNEKDQLLLMEKRCPVSLEGNSTPQNSVKNMYEKTITIAKGNSS
LGMTVSSNKDGLGMIVRSVIHGGSISRDGRIGVGDCILSINEESTTNLTNAQARAMLRRH
SLIGPDIKSSPAPADDQALCYVITYVPSENLDEYRASLGQQTEGALPLEPFPSHVVRELP
ELPEREEGEGEESELQNSAFSNWNQPRKVELWREPSKSLGISIVGGRGMGSRLSNGEVMR
GIFIKHILEDSPAGKNGTLKTGDRIVEVDGIDLRDASHEQAVEAIRKAGNPVVFMVQSII
SRPRPESLYSPSSASAPCGQKTTNPFYRQSPKSPSLPFLQNSVFSRPAVFSSTNPFADSS
QFNTTKEVSNPIRVTFRCSPTNPFAPTPFKAFGQSDTEPEKTPLCNLPVPPPSAFSGMSS
DVAQSSSIRVPEDVEKEDEFGYSWKKIVQRYGTLPGELHMIELEKGKTGLGLSLAGNKDR
SRMSVFIVGIDPNGAAGKDGRLQIADELLEINGQILYGRTHQNASSIIKCAPSKVKVIFI
RNKDAVNQMAVCPAKSVEASQCTSGTLQHQEIDISVAKASAFSDLSSCKNIQYVELPKDQ
GGFGIAISEDDTTNGVVIKSLTDHGAAAKDGRIKIGDVILAVDDEIVVGYPVEKFISLLK
TSKSVVRLTINPAETDNLTTAPAPPSTVPAEKRNMQPPAAVPTSSSPEPEAVKNASRSST
PAMLTSDPATCPIIPGCETTIDISKGRTGLGLSIVGGADTLLGAIIIHEVYEEGAASKDG
RLWAGDQILEVNGIDLRNATHDEAINVLRQTPQKVRLTVYRDEAQYKEEDMYDVLNIELQ
KKPGKGLGLSIVGKRNDTGVFVSDIVKGGIADTDGRLMQGDQILTVNGEDVRNANQEAVA
ALLKCSLGTVRLEVGRIKAGPFHSERRTSQSSQVSEGSGSLSSFSFPVSGSGAPEVFESG
LKRHTTTSEIQGLRTVEIKKNPTDSLGVSIAGGVGSPLGDVPIFIAMMHPNGVAAQTQKL
RVGDRIVSICGTSTEGMTHSQAVNILKNASGTIELQVVAGGEVSVITGQQQDPPIPSLSF
AGLTSTGIFQDDLGPPQYKTITLDRGPDGLGFSIVGGYGSPHGDLPIYVKTVFAKGAAAE
DGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLTVLS
NT seq 6432 nt   +upstreamnt  +downstreamnt
atgttggaaacaattgatatgcatcgggccctccaggccatggagcgcttacaggcaaaa
cttcgggatcgaggtgacatcgcaaatgaggagaaactgagcctattaaaatcagtgctg
cagagtcctctctttaatcaaattctgagccttcagacttctgttcaacaactaagagat
caggttaatattacaccttccatacattccagtggtgaattccctcagcttctccatcat
ggtgtgaacgttgggtccttgccacttaatgagtcatatttgttggctcagccgaatggc
aacccagctaatgtgttagaaacatcaatgagatccattactcctcagattaatgggaaa
ttctgtagtgaggactttgagcagctgatcagaaacatgtcccagggtcgtctggttgag
acaattgaccttattaaacctctaagtggtggtctgggcttcagtgttgtgggactcaag
agtgaaaacaggggcgaactaggaatatttgtgcaagaaatccaggagggaagtgtggca
catagagatggaaagctgaaggaagcagatcaaatccttgctattaatggacaagccctt
gaccagacaattacacatcagcaggctatcagcattttgcagaaagcaaaagataatgtc
cagctagttgtggctagaggcacttttcctcagctcatcagtcctgtggtttcccggtct
ccatctgctgctagcacagtttcagcccattccaacccggttcactggcagcatgtggag
accatagagttggtcaatgatggctccggtctgggatttgggatagtggggggaaagtca
actggagtgattgttaaaaccatcctccccggaggggtggctgatcagcatggaagattg
tgcagtggagatcacatcttgaaaattggtgatacagacctagctggaatgagcagtgag
caggtggcacaagttctaaggcagtgtggaaatagagtgaaactggtaattgcaagaggt
cctgttgaggagccgcttctgccagcagttcctccaggtacaccagtacccacctctaca
ccagagaaacaggatgatgcttctgttgatagctgtgaagatggggagaaattcaatgtt
gaactcactaaaaacaaccagggcttaggaataactattgctggttacattggagacaaa
acatcagaaccttctggtatttttgtgaaaagcattacaaaaggcagtgctgttgaacat
gatggcagaatccatgtgggagatcaaattatagttgtggatggaacaaatcttcagggt
tttactaaccagcaagcagttgatgttttgcggcacacgggacaaacagttcgcctcact
ttgatcagaagaggtcgtaagcaggaaaattgtattccaccccaggaggacttcagtgct
cctgttgagcaggacttactgttccaaacaagggatagtaccacagccaaagataacaat
gaaacagagcagggatccccatcactgccatgcagtgccagtgtggtaaatattggagat
gacatgaaacaacaggaaacaggttctcaagatttccagctaactagtacagaagaagcg
gctgcaaagataaaatggcagaggattatgggttcaaattatgaaatagtggtggctgtg
gttaacaaatttagtgaaagcagtgggttagggataagccttgaagctaccgtgggtcat
catttcatcagatctatcttacctgaagggccagttggacgaagcggcaagctattcagt
ggagatgaactgctagaagtgaatgagatctctcttcttggagaaaaccacaaggatgtg
gtcagtatcttgaaagagctgcctattaaggtgacaatggtgtgctgtcgtccagtagct
ccacctgtcactcagccagaaatactagagagtctaagcctatctgaggttcagctcaca
gaaaagggtcacatagaacttggatttgttggttcctcagacacagagggaacacctttg
gaaacagctgatgagggtcagagtatggaagaggtgcaaagctcatctctggcaatgtgg
gaaacagaagtacagcacattgagctggagaaagggagtatggggcttggatttagcata
ttggactatcaggatcctgttgatccagcaaacactgtaattgtgattcgctcgttagtt
cctgggggtgtggctgagcaagatggcagacttcttcctggagatcggcttatgtttgtc
aatgatatcaacttggaaaatggcagcctggaggaagccgtgcaagcactgaaaggagcc
ccaacaggaaaagttaaaataggagttgccaaaccattgcctctttcgcctgaggagggc
tatgtctctgctaaggaagattgctttttctacactgcccagtcacttgaggaggagggg
ccagctgatgcagccctcttccgtgctgagctggctctggtggactctggcgaggcagat
ctagcggatgagtccacctttgaagcacagtactctctagagagagacgtcttccaggat
tcagtggcagctctgcacgacggtgcctgtagcagtgaggtgcacgacagcttctctctt
ccattatcaattcccaagtctcttggagaggaatgcccaaatgctgcacctgatttccgt
gtatctgagaagaatctgtacaacatgaatttgaatcagagactaagagatgaaaagtct
gtagcggacagtagcctggaaacagcaagtgattttactaaaatagatcttttgacactt
gaggtttcagataccaaccaaaatgaaaatatagcaacatggactggatctcagacaaca
tcagaaattgtactaaatacaagccttgctactaccacacaacttgatcccaatgaaaaa
gatcaattgcttttaatggaaaagagatgcccagtatctttggagggaaattccacaccc
caaaattcagttaaaaacatgtatgagaagactatcactattgcaaaaggcaattcaagc
ctagggatgacagtaagttccaataaagatggtttgggaatgatagttcgcagtgtcatc
catggaggctcaataagtcgtgatggacggattggtgtgggggactgcatcctgtccatt
aatgaagagtcaaccactaacttaaccaatgcacaagcccgggctatgctgagacgacat
tcactcattggaccagacataaaatcttctccagcacctgctgatgatcaggccctgtgt
tatgttattacatatgtgccatcagaaaatttagacgagtacagggccagcctgggacaa
cagacagagggagcactaccacttgaaccttttccttcacatgttgtcagggaacttcca
gagcttccagaacgtgaagagggggagggagaagaaagtgaacttcaaaattcagctttc
agtaactggaaccagcccagaaaggttgaactctggagagagcctagcaagtcattgggc
atcagcattgttggaggacgagggatgggaagccgcctgagcaatggagaagtgatgaga
gggatttttatcaaacacatcctggaagacagcccagctggcaaaaatggaacactgaaa
actggagatcggattgtagaggtggatggaattgacctcagagatgccagccatgaacaa
gctgtggaagccatacggaaggcaggcaatcctgtagtctttatggtacagagcattata
agcagaccaaggccagagtctctttatagtccttcttcagcttctgctccctgtgggcag
aaaactactaacccattttatcgtcagtcacctaagagcccttccctgccttttctgcag
aacagtgttttcagtaggccagctgtcttcagcagcactaacccatttgctgattcttct
cagttcaacactactaaggaggtatcgaatccaattagggttaccttccgttgttcccca
actaacccttttgctcccacaccattcaaggcatttggtcagtctgatacagaaccagaa
aagactccactttgtaacttgcctgtgccccctccttcagcattttcaggaatgagctct
gatgttgcacagtcatcttctatcagagtcccagaagatgtggaaaaggaggatgaattt
ggttacagctggaaaaagattgtgcagcgctatggaactctaccaggggagctacacatg
attgagctggaaaaaggaaagacaggtctgggacttagtcttgctggtaacaaagaccga
tccaggatgagtgtctttatagtgggaattgatccaaatggagcagctggaaaagatggc
aggttacagattgcagatgagttgctagagataaatggccaaatcctttatggaaggact
catcagaatgcttcttcaataatcaagtgcgcaccatctaaagttaaagtaatctttata
agaaacaaggatgcagtaaatcagatggctgtttgccctgcaaagtcagtagaagcttct
cagtgtacttcagggacacttcaacatcaagagattgacatcagtgttgcaaaagcaagt
gcattttctgacttaagttcatgtaaaaacattcagtatgtggaacttcctaaggatcaa
ggaggctttggaattgccattagtgaagacgacacaactaatggagtagttattaaaagc
ttaacagatcatggtgcagctgcaaaggatggacgtatcaaaattggagatgtgattctg
gcagtggatgatgaaattgttgtgggatatcctgtagaaaagtttattagtctcctgaag
acatccaaatctgtggtgaggcttacaattaacccagcagagacagataacctgactaca
gcaccagcccctcccagcactgttccagcagagaagaggaatatgcaaccaccagcagct
gtccccacttccagctcaccagaaccagaagcagtcaaaaatgcaagcaggtcttcaact
ccagccatgttaacctctgacccagctacttgtcccatcattcctggatgtgaaacaact
attgatatctccaaagggcggactggtcttggtctgagcattgttggaggagcagacact
ttgctgggagcaatcattatccatgaggtatatgaagaaggagcagcatctaaagatgga
cgactgtgggctggtgatcagatactagaggtgaatggaattgacctcaggaatgccaca
catgatgaagccattaatgtcctccgtcagacaccccaaaaagttcgtctgactgtgtac
agagatgaagcccagtacaaggaggaagacatgtatgatgtgctgaatatagagctccag
aagaagcctggtaaaggccttgggctgagtattgttgggaaacgaaatgacacaggtgtg
tttgtgtcagacattgtcaaaggaggaatagcagatacagatgggagattgatgcaagga
gaccagatattgacagtgaatggagaagatgtccgaaatgctaaccaggaggctgttgca
gctttgctaaagtgttccttaggtacagtaagactagaggttggaagaataaaagctggg
ccatttcactctgaaaggagaacatctcagagcagtcaggtcagtgaaggaagtggcagt
ctctcatcgttcagtttcccagtttctgggtccggtgcacccgaggtctttgaaagtggc
ctaaagaggcataccacaacttctgaaatacagggactaagaacagttgaaataaaaaag
aaccctacagattcactaggagtgagcattgctggaggtgtaggaagtcctcttggagat
gttcctatatttattgccatgatgcacccaaatggagttgcagcccagactcagaaatta
agagttggggacaggattgttagcatctgtggaacatctaccgagggcatgactcattcc
caagctgttaatatcttaaaaaatgcttcaggcactattgagttgcaggttgtagctgga
ggagaagtgagtgtcataactggtcagcagcaggatccgcctatccccagtctttcattt
gcaggactaacttcaactggcatttttcaggatgatttaggacctcctcagtacaagacc
atcactctggacagaggaccagacggccttggctttagtattgtaggtggctatggcagt
ccgcatggagacttgcccatttatgtgaagacagtgtttgcaaagggtgcagcagcagaa
gatggacgcctcaagaggggggatcaaataattgctgtgaatgggcagagtttagaaggg
gtgacccatgaggaagcagttgctattctgaaaaggacaaaaggaacagtcactttgact
gtgttgtcatga

DBGET integrated database retrieval system