KEGG   Taeniopygia guttata (zebra finch): 100230398Help
Entry
100230398         CDS       T01082                                 

Gene name
FRS2
Definition
(RefSeq) fibroblast growth factor receptor substrate 2
  KO
K12461  fibroblast growth factor receptor substrate 2
Organism
tgu  Taeniopygia guttata (zebra finch)
SSDB OrthologParalogGFIT
Motif
Pfam: IRS
Motif
Other DBs
NCBI-GeneID: 100230398
NCBI-ProteinID: XP_002190742
Ensembl: ENSTGUG00000006906
UniProt: H0Z952
Position
1A
AA seq 508 aa AA seqDB search
MGSCCSCPDKETVPDNHRNKFKVINVDDDGNELGSGIMELTDTELVLYTRKRDSVKWHYL
CLRRYGYDSNLFSFESGRRCQTGQGIFAFKCARAEELFNMLQEIMQNNSINVVEEPVVER
NNHQTELEVPRTPRTPTTPGFNAQSLPNGYPRYPSFGDASSHPSSRHPSVGSARLPSVGE
ESTHPLLVAEEQVHTYVNTTGVQEERKNRSSVHVPLESKLSNTETTKVKEDQMCTDDRDA
QVLLEPEGVKFVLGPTPVQRQLMEREKLEQLGRDQVSGSSTNNTEWDTGYDSDERRETPS
GNKLVYENINRLSIPSASGVRRGRLTSTSTSDTQNINNSAQRRTALLNYENLPSLPPVWE
ARKLSRDEDDSLGPKTPSLNGYHNNLDLMHNYVNTENVTVPASAHKVEFTRRRDCTPTVF
NFDIRRPSLEHRQLNYIQVDLEGGSDSDNPQTPKTPTTPLPQTPTRRTELYAVIDIERTA
AMSSLQKALPRDDGTSRKTRHNSTDLPM
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgggtagctgttgtagctgtccagataaagaaactgtcccagataaccaccgaaacaaa
tttaaggttattaatgtggatgacgatggtaatgaactgggttctggcataatggaactt
acagatacagaactagttttgtacacccgtaaaagggactctgtaaaatggcactacctc
tgtctccgtcgctatggctatgactcaaatcttttctcttttgaaagtggtcgaaggtgt
caaactggacaaggaatctttgcctttaagtgcgcccgggcagaagagctatttaacatg
ttacaagagataatgcagaataatagcataaatgtggtagaagaaccagtagtagaaagg
aataatcatcaaactgagttggaagtaccaagaacccctcgaacacctaccactcctgga
ttcaatgcacaaagtttacccaacggctatcccagatacccatcttttggagatgcttca
tcacacccttccagcagacatccttctgtcggcagcgcacgcctcccctctgtcggtgaa
gaatcaacacatcctttacttgtagcagaggagcaagtgcacacttatgtaaacactact
ggagtacaagaggaaagaaaaaatcgatcaagtgtgcatgtgccactggaatcaaagctt
tcaaacactgaaacaactaaagtgaaagaagaccagatgtgtactgatgacagagatgct
caggttctcctggagcctgagggagtgaagtttgttttaggaccaacacctgttcaaagg
cagttaatggaaagagagaaactggaacaacttgggagagatcaagttagcggcagcagc
acaaacaacactgaatgggacactgggtacgacagtgatgaacgtagagagacaccatct
ggtaataaattggtgtatgaaaatataaataggttatcaatccctagtgcctcaggggtc
aggagaggtcgcttaacatcaaccagtacctcagacacccagaacattaacaactctgct
cagaggagaactgcgctgctgaactatgagaacttgccatccttgcctcctgtttgggaa
gcccggaagctgagcagagatgaagatgacagtttaggaccaaagaccccgtctctgaat
ggctaccacaataacctagatctaatgcataactatgtcaatacagagaatgtaacagta
ccagcaagtgctcataaagtagaatttacacgacgtcgggactgtaccccaacagtcttt
aactttgacattaggcgtccaagtttagaacacaggcagctcaactatatacaggttgac
ttggaaggtggtagtgactctgacaaccctcagactccaaaaacccccaccactccactt
ccgcaaactccaaccaggcgcacagagctgtatgctgtgatagacattgaaagaactgct
gctatgtcaagcttgcaaaaagcactgccccgagatgatggtacttctaggaaaactaga
cataacagtactgacctgcctatgtga

DBGET integrated database retrieval system