KEGG   Taeniopygia guttata (zebra finch): 100230890Help
Entry
100230890         CDS       T01082                                 

Definition
(RefSeq) cytochrome P450 1A5-like
  KO
K07408  cytochrome P450 family 1 subfamily A polypeptide 1 [EC:1.14.14.1]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu00140  Steroid hormone biosynthesis
tgu00380  Tryptophan metabolism
tgu00830  Retinol metabolism
tgu00980  Metabolism of xenobiotics by cytochrome P450
tgu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100230890
  Amino acid metabolism
   00380 Tryptophan metabolism
    100230890
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100230890
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100230890
Enzymes [BR:tgu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100230890
Cytochrome P450 [BR:tgu00199]
 Cytochrome P450, animal type
  CYP1 family
   100230890
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 100230890
NCBI-ProteinID: XP_002195788
Ensembl: ENSTGUG00000003977
Position
10
AA seq 529 aa AA seqDB search
MPGAAVWPAGSPGAVWASEALLAAAAFFELLLALQRLRPPGAVPEGLRRPPGPRGFPVLG
NVLELRRDTHLALTRLGRRYGDVMEVRIGTRPVLVLSGLDTIRQALVRQGDDFMGRPDLY
SSRFVADGQSLTFSPDSGEVWKARRKLAQSALKSFSIAPSPTSSCSCLLEEHVSKEAEYL
VTKFLQLMEEEKSFEPCRYLVVSVANVICAICFGKRYEHEDQELLRLVNSSEKFTDVAAA
GNPADFIPLLRYLPSRSMKLFIDFNRYFVGFLQRRVKEHYETYDENNIRDITDSLIEQCL
DKKLGTNTAAQIPKEKIVNLVNDLFGAGFDTVTTALSWSLMYLVTNPNIQKKIHEELDRT
IGRERRPRLSDRGTLPYTEAFILEMFRHSSFLPFTIPHSTTKDTVLNGYFIPKDRCVFVN
QWQVNHDEKLWKDPETFNPERFLSADGTRVNKEDAEKVLVFGLGRRRCIGENIARSQVFL
FLVTLLQQLEFSVCEGGRVDMTPLYGLSLKHKRCEHFQVRQRFPVKGRS
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgccgggcgctgccgtgtggccggcggggagccccggcgcggtgtgggccagcgaggcg
ctgctggcggccgccgcctttttcgagctgctgttggcgttgcagcggctgcggccaccc
ggggccgttcccgaggggctgcggcggccgccgggcccgcggggcttccccgtgctgggg
aacgtgctggagctgcgccgggacacgcacctggcgctgacgcggctcggccgccgctac
ggggacgtgatggaggtgcgcatcggcacccggcccgtgctggtgctcagcgggctggac
accatcaggcaagccctggtcaggcaaggagacgacttcatggggcgccccgacctctac
agttcccgctttgtggcggacgggcagagcctgacgttcagccccgactccggggaggtg
tggaaagcgcgcaggaagctggcccagagcgccctgaagagcttctccatcgcccccagc
cccacctcgtcctgcagctgcctgctggaggagcacgtctccaaggaggccgagtacctg
gtcaccaagttcctgcagctgatggaggaggagaagagtttcgagccctgccggtacctg
gtggtgtcggtggccaatgtcatctgtgccatttgctttggcaagcgctacgagcacgag
gaccaggagctgctcaggctggtgaattcatcggagaagttcactgacgtggctgctgct
ggcaaccccgccgacttcatccccctcctgcgctacctccccagccgcagcatgaagctg
ttcatcgatttcaacaggtacttcgtcggcttcctgcagaggagggtcaaggagcactac
gagacctacgacgagaacaacatccgggacatcacggactccctcattgagcagtgcctg
gacaaaaaactgggaacaaacacggccgcgcagatccccaaggagaagatcgtcaacctc
gtgaacgacctctttggagcaggcttcgacaccgtaaccacagccctgtcctggagcctc
atgtaccttgtgacaaaccccaacatccagaagaagatccacgaagagctggaccggacc
atcgggcgggagaggcggccgcggctgtcggaccggggcacgctgccctacacggaagcc
tttatcctggagatgttccggcattcctccttcctgcccttcaccatcccacacagcacc
accaaggacacggtgttgaacggctacttcatcccaaaggatcgctgcgtgttcgtcaac
cagtggcaagtgaaccacgacgagaagctttggaaggacccagaaaccttcaaccccgag
cgtttcctcagcgctgacgggaccagagtgaacaaagaggacgcggagaaggtgctggtg
ttcggcctggggaggaggaggtgcatcggggagaacattgccaggagccaggtgttcctc
ttcctggtcacgctgctccagcagctggagttcagcgtctgcgagggcggcagggtggac
atgaccccgctctacggactgtccctgaagcacaagaggtgtgagcacttccaggtcagg
cagcgcttccccgtgaagggcaggagctga

DBGET integrated database retrieval system