KEGG   Taeniopygia guttata (zebra finch): 100231196
Entry
100231196         CDS       T01082                                 

Gene name
OTP
Definition
(RefSeq) homeobox protein orthopedia
Organism
tgu  Taeniopygia guttata (zebra finch)
SSDB
Motif
Pfam: Homeodomain OAR Homeobox_KN
Other DBs
NCBI-GeneID: 100231196
NCBI-ProteinID: XP_030114390
Position
Z
AA seq 325 aa
MLSHADLLDARLGMKDAAELLGHREAVKCRLGVGGSDPGGHPGDMAPNSDTVEGTTLLPG
EDITTVGSNPSSLAVSAKDPDKQQGQQGGQNSSQAGQQQGQQKQKRHRTRFTPAQLNELE
RSFAKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTTNVFRAPGTLLPTPG
LPQFPSAAAAAAAAMGDSLCSFHANDTRWAAAAMPGVSQLPLPPALGRQQAMAQSLSQCS
LAAGPPPNSMGLSNSLAGSNGAGLQSHLYQPAFPGMVPASLPGPSNVTGSPQLCSSPDSS
DVWRGTSIASLRRKALEHTVSMSFT
NT seq 978 nt   +upstreamnt  +downstreamnt
atgctgtctcacgccgacctcctggacgcccgtctcgggatgaaagacgccgccgagctg
ctgggacaccgggaggcggtcaagtgtcggctgggcgtcgggggctcggatccgggggga
cacccgggagacatggctcccaactcggacacggtggaagggaccaccctgctgccgggg
gaggacatcaccacggtgggatccaaccccagctccctagccgttagcgccaaagaccct
gacaagcagcaaggccagcagggcggccagaactccagccaggccgggcagcagcagggt
cagcagaagcagaagcggcaccgcactcgcttcacgccagctcagctcaacgagctggag
aggagcttcgccaagactcactacccggacatcttcatgcgggaggagctggccctgcgc
atcggtctcaccgagtcccgggtgcaggtctggttccagaaccgccgcgccaagtggaag
aagcgcaagaagaccacgaacgtgttccgcgccccgggcacgctgctgccgacgccgggg
ctgccgcagttcccctcggccgccgccgccgccgccgccgccatgggggacagcctgtgc
tccttccacgccaacgacacgcgctgggccgccgccgccatgcccggcgtgtcgcagctg
ccgctgccgccggcgctgggacggcagcaagccatggcgcagtccctgtcccagtgcagc
ctggcggccggcccgccgcccaactccatgggcctctccaacagcctggcgggctccaac
ggcgccgggctgcagtcccacctctaccagcccgccttccccggcatggtgcccgcctcc
ctgcccggccccagcaacgtgacgggctctccccagctctgcagctccccggacagcagc
gacgtgtggcggggaaccagcatcgcctccctccgccgcaaagcactagagcacacagtc
tccatgagtttcacctaa

DBGET integrated database retrieval system