KEGG   Taeniopygia guttata (zebra finch): 100232535Help
Entry
100232535         CDS       T01082                                 

Gene name
PLB1
Definition
(RefSeq) uncharacterized LOC100232535
  KO
K14621  phospholipase B1, membrane-associated [EC:3.1.1.4 3.1.1.5]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu00564  Glycerophospholipid metabolism
tgu00565  Ether lipid metabolism
tgu00590  Arachidonic acid metabolism
tgu00591  Linoleic acid metabolism
tgu00592  alpha-Linolenic acid metabolism
tgu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100232535 (PLB1)
   00565 Ether lipid metabolism
    100232535 (PLB1)
   00590 Arachidonic acid metabolism
    100232535 (PLB1)
   00591 Linoleic acid metabolism
    100232535 (PLB1)
   00592 alpha-Linolenic acid metabolism
    100232535 (PLB1)
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100232535 (PLB1)
    3.1.1.5  lysophospholipase
     100232535 (PLB1)
Membrane trafficking [BR:tgu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100232535 (PLB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Metallophos STPPase_N Lipase_GDSL
Motif
Other DBs
NCBI-GeneID: 100232535
NCBI-ProteinID: XP_012427663
Position
3
AA seq 706 aa AA seqDB search
MEKALLSEDVPNTFATAKWANNADILKKFNPNLFGFSTGTSKETAGFNVAERNATARDMP
AQARALVELMRSSSKINFKEDWKLITILVGGSDLCQYCLDKETYSVQKYVMHLQDTLDIF
YEEKINFKEDWKLITILVGGSDLCQYCLDKETYSVQKYVMHLQDTLDIFYEEAEALRLIS
GGRYEQREDFAVVIQPFLRNTLLPLDSTSKPDMSFFAADCFHFSVRGYAEMAMALWNNML
EPVGEKQTYNNFTHDRSKLRCPNPDKPFLSTRRNSGFGNSDLSLEKTESSVPYWAVIVAA
VGGILAARWQSCGGGATRLTQTLRARSSPSRGPGPLRACAAEPAAPARCRSAGRPQPPAA
HMRPAACGFTLEGSSRKPTQALMSTKLPSTVEYLISVRGCRPGKIVQMTEAEVRGLCIKS
REIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLE
TICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIA
AIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRG
VSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGM
MSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atggagaaagcactgctcagtgaagatgttccaaacacctttgctactgcaaagtgggca
aacaatgcagacatcttgaaaaaattcaatccaaacctctttggcttctccactggcact
tctaaggaaacagctggattcaacgttgcggagagaaatgccacagcacgtgatatgcca
gcccaggcacgtgcattggtggagctgatgagaagcagctccaaaattaacttcaaggaa
gactggaagctgattaccatccttgttggaggcagcgacctgtgccagtactgcttggac
aaggaaacctattcagtgcaaaagtatgtaatgcaccttcaggacactctggatattttc
tatgaggagaaaattaacttcaaggaagactggaagctgattaccatccttgttggaggc
agcgacctgtgccagtactgcttggacaaggaaacctattcagtgcaaaagtatgtaatg
caccttcaggacactctggatattttctatgaggaggctgaagccttgcggctgatcagc
ggcggtcggtacgaacagcgggaggactttgccgtggtcatccagccattcctcaggaac
accttgctgcccctggatagtactagcaagccagatatgagtttctttgctgcagactgc
tttcatttcagtgtaagaggctatgctgagatggccatggctctctggaacaatatgctg
gagccagttggtgaaaagcagacttacaacaactttacccatgacagatcaaaactcaga
tgtccaaaccctgataaaccttttctttccacgagaagaaatagtggatttggaaattca
gatctcagcttggagaaaacagaatcttcagtcccttactgggcagtcattgtggctgca
gtaggggggatcctggctgcgaggtggcagagttgcggcggaggggcgacccggctgaca
cagacgcttcgggctcgttcttcgccctcacgcgggccgggcccgctccgcgcctgcgcc
gccgagcccgccgcgcctgcgcgctgccggagcgcggggcggccgcagcctcctgctgct
cacatgcgccctgctgcttgtggattcactctagagggaagctcaagaaagcccacccag
gccctgatgtccacaaagttaccttcaactgttgaatatctcatttcagtacgaggatgt
cgtcctgggaagattgttcagatgaccgaagcagaagttcggggcttgtgcataaaatca
cgggaaatatttcttagccagcctattcttctggaactagaggcacctctgaaaatttgt
ggtgatatccatggccagtatacagacttgcttcgattatttgaatatggaggattccca
ccagaagctaattatcttttccttggagattatgtagacagaggcaaacagtctctggaa
acaatttgcctattactggcatataaaatcaagtacccggaaaacttctttctcctaaga
ggaaatcatgagtgtgctagcatcaatcgcatctatggattttatgatgaatgcaagcgg
agatttaacattaagctgtggaaaaccttcacagactgttttaactgcctgcctattgca
gccattgtggatgagaagatcttctgttgtcatggaggactgtctccagatctccagtca
atggagcagatccggagaattatgagacctacagatgttcctgacacaggtttgctctgt
gacctgctgtggtctgacccagacaaagatgtgcaaggttggggtgaaaatgatcgtggg
gtctctttcacttttggtgctgatgtggtcagtaaatttctgaatcgtcatgatctggat
ttgatctgtcgagctcatcaggtggttgaagatggatacgagttctttgctaaacggcag
ttggtcaccctattctcagctccaaactattgtggagagtttgacaatgcagggggcatg
atgagtgtggatgaaactctgatgtgttccttccagatattgaaaccatctgaaaagaaa
gccaagtaccagtatggtggactgaattctgggcgtccagtcactccacctcgcacagct
aacccaccgaagaagaggtga

DBGET integrated database retrieval system