KEGG   Taeniopygia guttata (zebra finch): 115490547Help
Entry
115490547         CDS       T01082                                 

Definition
(RefSeq) arylamine N-acetyltransferase, pineal gland isozyme NAT-10
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu00232  Caffeine metabolism
tgu00983  Drug metabolism - other enzymes
tgu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    115490547
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    115490547
Enzymes [BR:tgu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     115490547
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-GeneID: 115490547
NCBI-ProteinID: XP_030138471
Position
11
AA seq 290 aa AA seqDB search
MNLEEYFARTGYKGSTEKQDLETLTDIFQHHIRAVPFENLSIHCGEKITLELEHVYNKIV
RRKRGGWCMENNQLLGWVLRGLGYETSFLGAYVFNPHQNAYATLMTHLVVKVVIDGKAYV
VDGGFGVSYQMWQPMELVSGKDQPQAPGVFRFTEKNGVWYLEKMRRKQYIPNQSFSNSDL
LEKKECRKVYMFSLEPRTVEDFSFQCTYLQTSPDSLFTKKSICTLQTTDGFRALIGWTLT
ETTYNYKENMDLVEFVTLEDEEVEKTLKEKFNITLERKLVPVNVKGSYTI
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaaccttgaagagtattttgcaagaactggctataaaggctccactgaaaaacaagat
ttggaaaccttaaccgatatattccagcatcacatccgtgccgttccctttgaaaacctc
agcatccactgcggggagaaaattactttggagttggagcatgtttacaacaagattgtg
cggaggaagcggggtggctggtgcatggagaacaaccagctgctgggctgggtgctgagg
ggcctggggtatgagaccagcttcctgggagcctacgtgttcaacccccaccagaacgcc
tacgccaccctcatgacccacctggtggtaaaggttgtcatcgatggcaaagcctatgtc
gttgatggaggctttggggtgtcctaccagatgtggcagcccatggagctcgtgtcaggg
aaagaccagccccaggcccccggcgtcttccgcttcacggagaaaaacggtgtctggtac
ctggagaaaatgagacggaaacaatacatccccaatcagagcttctccaactctgacctg
ctggagaaaaaagagtgtcgcaaagtttatatgttcagccttgagccacggacagtggaa
gatttcagctttcagtgcacatacctccagacctctccagattccctcttcacaaagaaa
tccatctgcaccctccagacaaccgatggattccgagcgctaattgggtggacactcact
gagaccacgtacaactacaaggaaaacatggatctggtggaatttgtaactcttgaagat
gaagaggtggaaaaaaccctcaaagagaaatttaacatcaccctagagagaaaacttgtc
cccgttaatgttaaaggatcttacacaatctaa

DBGET integrated database retrieval system