KEGG   Taeniopygia guttata (zebra finch): 115492064Help
Entry
115492064         CDS       T01082                                 

Definition
(RefSeq) glucose-6-phosphate 1-dehydrogenase-like
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu00030  Pentose phosphate pathway
tgu00480  Glutathione metabolism
tgu01100  Metabolic pathways
tgu01200  Carbon metabolism
Module
tgu_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
tgu_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    115492064
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    115492064
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tgu04147]
    115492064
Enzymes [BR:tgu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     115492064
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     115492064
Exosome [BR:tgu04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   115492064
  Exosomal proteins of colorectal cancer cells
   115492064
  Exosomal proteins of bladder cancer cells
   115492064
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-GeneID: 115492064
NCBI-ProteinID: XP_030116511
Position
Unknown
AA seq 540 aa AA seqDB search
MGTRASVREAARARPEREGAMPGSGGGELSRSQVCGMLRQELSRDGAFLQGHPHVLVILG
ASGDLARKKIYPTIWWLFRDGLLPDATRVVGFARSPLTVELIREQTLPYLKVTPEDEPRL
ARFLSLQSFVRGQYGDEASFRALDAHLRALPGGDRAHRLFYLALPPSVYTPVTQHLRALC
MGQGWNRVIVEKPFGRDLGSSEELSAHLSALFREEQIYRMDHYLGKEMVQSLMVLRFGNR
IFGPIWNRDNVACVVLTFKEPFGTEGRGGYFDDFGIIRDVMQNHLLQLLCLVAMEKPAST
NPDDVRDEKVKVLKCISPVELQDVVLGQYVGNPEGPPEAQKGYLDDPTVPPGSTTPTFAT
AVLRVANERWDGVPFVLRCGKALNERKAEVRLQFREVPGDIFAQQCKRNELVVRVQPREA
VYAKLNTKKPGMFLRPEESELDLTYGSRYKDVKLPDAYERLLLDVICGNQMHFVRSDELR
EAWRIFTPLLHQIEQRREPPIPYTYGSRGPPEADELLRRAGFLYEGTYRWVPPPAPDPHP
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atggggacccgcgcgagcgtgagggaggcggcgcgagcgcggccggagcgggaaggagcg
atgccgggctcgggcgggggggagctgagccgctcgcaggtgtgcgggatgctccggcag
gagctgagccgggacggagccttcctccagggccacccgcacgtcctcgtcatcctcggc
gcctccggtgacctggccaggaagaagatttaccccacgatctggtggctgttccgggac
gggctcctccccgatgccacgcgcgtcgtcggcttcgcccgctcgcccctcaccgtggag
ctcatccgggagcagaccctgccctacctcaaggtgacccccgaggacgagccccgcctg
gcccggttcctgtccctgcagagcttcgtgcggggtcagtacggggacgaggcctcgttc
cgggcgctggacgctcacctgcgggcgctgcccgggggcgaccgcgcccaccgcctcttc
tacctggccctgccccccagcgtgtacacacctgtgacccagcacctgagggccctgtgc
atgggacaggggtggaaccgcgtgatcgtggagaagccctttgggcgggacctgggctcc
tcggaggagctgtcggcgcacctgagcgcgctgttccgcgaggagcagatctaccgcatg
gaccactacctgggcaaggagatggtgcagagcctcatggtgctgcggttcggcaaccgc
atcttcgggcccatctggaaccgcgacaacgtcgcctgcgtggtgctcaccttcaaggag
cccttcggcaccgagggccgcggcggctactttgacgacttcggcatcatccgggacgtg
atgcagaaccaccttctgcagctgctctgcctggtggccatggagaagccggcgtccacc
aaccccgatgatgtccgtgacgagaaggtgaaggtgctcaagtgcatcagcccggtggag
ctgcaggacgtggtgctgggccagtacgtgggcaaccccgagggcccccctgaggcacag
aagggctacctggacgaccccacggtgccccctggctccaccacgcccaccttcgccacc
gccgtgctgcgtgtggccaacgagcgctgggacggcgtcccgttcgtgctgcgctgcggg
aaggcgctgaacgagcgcaaggccgaggtgcggctgcagttccgggaggtgcccggggac
atcttcgcgcagcagtgcaagcgcaacgagctggtggtgcgggtgcagccgcgcgaggcc
gtctacgccaaactcaacaccaagaaacccggcatgttcctgcggcccgaggagtccgag
ctcgacctcacctacggcagccgatacaaggacgtgaagctgccggacgcgtacgagcgg
ctcctgctggacgtcatctgcgggaaccaaatgcacttcgtgcgcagtgacgagctgcgc
gaggcctggcgcatcttcacccccctcctgcaccagatcgagcagcggcgcgagcccccc
atcccctacacctacggcagccggggtccccccgaggcggacgagctcctgcggcgggcg
gggttcctgtacgagggcacctatcgctgggtgcccccccccgcgcccgacccccacccc
tga

DBGET integrated database retrieval system