KEGG   Taeniopygia guttata (zebra finch): 115495257
Entry
115495257         CDS       T01082                                 

Gene name
APLN
Definition
(RefSeq) apelin isoform X1
  KO
K05225  apelin
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu04080  Neuroactive ligand-receptor interaction
tgu04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    115495257 (APLN)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    115495257 (APLN)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 115495257
NCBI-ProteinID: XP_030128640
Position
4A
AA seq 109 aa
MAMPGTGGRARRHRERSAAMALVGDSARGQAAPRYRRPCPAWGDTWLTLLLISAGPLGKA
PDGKDAQNGLTRRLVRPRGARRGTGQRPGGWRRSRRPRPRLSHKGPMPF
NT seq 330 nt   +upstreamnt  +downstreamnt
atggccatgccgggcacaggtggccgggcccgccggcacagagagcgctcggcagcgatg
gctcttgttggggacagtgcccggggccaggcagccccacggtaccgccgtccctgtcct
gcgtggggggacacgtggctgacgctgctgctgatctccgcagggccgctggggaaggcg
ccggacgggaaggatgcccagaatgggctcacccggaggctggtgcggccgcggggcgca
cgccgtgggaccggccagcggcccgggggctggcggaggtcccggcggccccggccccgg
ctgtcccacaagggccccatgccgttctga

DBGET integrated database retrieval system