KEGG   Taeniopygia guttata (zebra finch): 751952Help
Entry
751952            CDS       T01082                                 

Gene name
GRIA1
Definition
(RefSeq) glutamate receptor 1 isoform X1
  KO
K05197  glutamate receptor 1
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    751952 (GRIA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:tgu04040]
    751952 (GRIA1)
Ion channels [BR:tgu04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   751952 (GRIA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 DUF659 Peripla_BP_6
Motif
Other DBs
NCBI-GeneID: 751952
NCBI-ProteinID: XP_002198407
Ensembl: ENSTGUG00000000726
Position
13
AA seq 902 aa AA seqDB search
MQHIFAFFCTSFLGAVLGANFPNNIQIGGLFPNQQSQEHAAFRFALSQLTEPPKLLPQID
IVNISDSFEMTYTFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPVETSNQ
FVLQLRPELQDALISVIEHYSWQKFVYIYDADRGLSVLQKVLDTAAEKNWQVTAVNILTT
TEEGYRLLFQELEKKKERLVVVDCETERLNIILNKIISLEKNGNGYHYILANMGFMDIDL
TKFRESGANVTGFQLVNYTDTVPARIMQQWRNNDAREHPRVDWKKPKYTSALTYDGVRVM
AEAFQNLRRQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLSGNVQFNEKGR
RTNYTLHVIEMKHDGIRKIGYWNEDEKLVPIAVDTQSGNESTSLQNRTYIVTTILEDPYV
MLKKNANQFEGNERYEGYCVELAAEIAKHVGYHYRLEIVRDGKYGARDPDTKTWNGMVGE
LVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIW
MCIVFAYIGVSVVLFLVSRFSPYEWHTEECEEGRDQPANEQTNEFGIFNSLWFSLGAFMQ
QGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIA
YGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLES
TMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRGPVNLAVLKLSEQGVLDKLKSKW
WYDKGECGSKDSGSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMK
GFCLIPQQSINEAIRTSTLPRPAAAGGSGENGRVVSHDFPKSMQTIPCMSHSAGMSLGAT
GL
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgcagcacatttttgccttcttctgcaccagttttctaggggcggtgttaggggccaat
ttccccaacaatatccagataggggggttatttcctaatcaacagtcccaggaacatgcg
gcctttaggtttgcgttgtctcagctcacagaaccccctaagctccttccccagatcgac
attgtgaacatcagtgacagctttgaaatgacttacaccttctgctcgcagttctccaag
ggtgtctatgccatcttcgggttttatgagaggaggactgtcaacatgctcacgtctttc
tgcggggccctccacgtctgcttcataacgccgagcttccccgtggaaacctccaaccag
tttgtcctccagctccgccccgagctccaggatgccctcatcagcgtcatcgagcactac
agctggcagaagtttgtgtacatttacgatgctgaccgggggttgtcagtcctgcagaaa
gtgctggacactgcagctgagaagaactggcaggtgacagctgtcaatatcctgacaaca
acagaggagggctaccgactgctcttccaggagctggagaagaagaaggagaggctggtg
gtggtggactgcgagactgagaggctgaacatcatccttaacaagatcatctcgcttgaa
aaaaatgggaatgggtaccactacattctggcaaatatgggattcatggacattgacctg
accaaattcagagagagtggagccaatgtcactggcttccaattggtgaattacacagat
actgttcctgccaggatcatgcaacagtggaggaataatgatgccagagagcatccacgt
gtggactggaagaagccaaagtacacgtcagccctcacgtacgacggcgtgcgggtgatg
gccgaggccttccagaaccttcggcggcagcgcatcgacatctcccgccgcggcaacgcc
ggcgactgcctggccaaccccgccgtgccctggggacagggcattgacatccagagagcc
ctgcagcaggtccgttttgaaggattgtctggcaacgtccagtttaacgagaaaggacgc
aggaccaactacaccctccatgtgattgagatgaaacacgatgggatcagaaagattggt
tattggaatgaagacgagaagctggtcccaatagctgtagatactcaaagtggcaatgag
tctacaagcctgcagaacaggacctacatcgtcacaactatcctggaggacccgtatgtg
atgctcaagaagaatgccaaccagtttgagggcaacgagaggtatgagggctactgcgtg
gagctggcggccgagattgccaagcacgtgggctaccactaccggctggagatcgtgcgc
gacggcaagtacggagcccgggaccctgacaccaaaacgtggaacggcatggtgggagag
ctcgtttatgggagggcagatgtggctgtggcaccattaaccatcaccctggttcgagaa
gaagttatagacttttccaagccattcatgagtttaggtatatcaataatgataaaaaaa
cctcaaaagtccaaaccaggagttttttcctttctggatcctttggcctacgagatatgg
atgtgcattgtttttgcctacattggagtgagcgttgtcctcttcctggtgagtcgcttc
agcccttatgagtggcacactgaggaatgcgaggaaggacgggaccagccagccaatgag
cagacaaatgagtttgggatattcaacagcctctggttctccctaggagctttcatgcag
caaggatgtgatatttctccaaggtctctctccggccgcatagtgggtggcgtctggtgg
ttcttcaccttgatcatcatatcctcctacacagctaacctggctgccttcctcaccgtg
gagaggatggtgtcacccatcgagagcgcagaggacttggccaagcagacagaaatcgcc
tatggcaccctggaagctggctccactaaagaattttttaggcgatccaaaatagcagtg
tttgagaagatgtggacatacatgaagtcagccgagccctccgtttttgtgaggacgacg
gaagaggggatgatccgggtgaggaagtccaaagggaagtacgcatacctcttggagtcc
acaatgaatgagtacatcgagcagcgcaagccctgcgacaccatgaaggtgggaggtaac
ttggactccaaaggctatggcattgctacgccaaaggggtctgcgctgagaggtcccgta
aacctagcggttttgaaactcagtgagcaaggcgtcttagacaagctgaaaagcaaatgg
tggtacgataaaggggaatgtggaagcaaggactccggaagtaaggacaagacgagcgcg
ctgagtctcagcaatgtggcgggggttttctatatcctcatcggtgggctcggactcgcc
atgctggttgccttaatcgagttttgttacaagtccagaagtgaatcaaagcggatgaag
ggtttttgtttaatcccacagcaatcaatcaacgaagccatacggacatcaacccttccc
aggccagctgcagcaggaggcagtggagaaaatggacgtgtggtcagccacgatttcccc
aaatccatgcagacgatcccatgcatgagccacagcgctggcatgtccctgggagctacg
ggattataa

DBGET integrated database retrieval system