KEGG   Thermococcus guaymasensis: X802_03780Help
Entry
X802_03780        CDS       T04184                                 

Definition
(GenBank) Na-dependent transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
tgy  Thermococcus guaymasensis
Brite
KEGG Orthology (KO) [BR:tgy00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    X802_03780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AJC71382
UniProt: A0A0X1KJH5
Position
657410..658372
Genome map
AA seq 320 aa AA seqDB search
MDAVGVAVIAVAFYIAWNIGSNDSANAMGTAVGAGILSFRQATLTIAIFTLLGAYLKGYK
VMKTVGKGIVPSGYLTIELAVIALLSAGVWVTIATVKGLPVSTTQAIVGGVLGVGLSIGA
PINWATMGKIAGAWVFSPVLSGIFAAILYKFYSYVVSNIKTISTIETLYKALAILGGSYM
AFNFGTNEVANASGPIVGAGVLEPKTAGVLVALSLAMGALTFSYAVMHTVGKKITALGPI
SAFAAQFGSAMSVSLANIFGLPVSSSQAIVGGVLGVGIIAGEKIDKRVIKDIIFGWVATP
TVAVLISIIVFRLFHLVGLV
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggatgcggtaggagtggcagtaatagcagtggcattttatatagcctggaacattggt
tcaaatgactccgccaatgctatggggaccgcggttggggcaggaatactgagcttccgc
caggcaacgctcacgatagctatattcaccctcctgggagcataccttaagggatacaag
gtcatgaagaccgttggaaaaggtatcgttccctctggatacctaacgattgaacttgcc
gttatagcacttctctcggcgggggtatgggttaccatagccaccgtcaagggactcccc
gtctcaacaacgcaggcgatagttgggggggttctgggcgttggcctcagcataggtgcc
ccaatcaactgggcaacgatgggaaaaatagctggagcatgggttttctcgccggttcta
tcgggaatcttcgcggcgattctctacaagttctattcgtatgtagtctccaacatcaaa
accatctcgacaatcgaaactctttacaaagcccttgcaattctgggcggctcttatatg
gccttcaactttgggacgaacgaggtggccaacgcctccggcccaatagttggggctggc
gtccttgagcccaaaacggcaggtgttcttgtagcccttagcctcgccatgggtgccctt
accttcagctacgcggtaatgcacacggtcggcaagaagataaccgccctcggccccatc
tcagcttttgccgcccagttcggatcggcaatgtcggtaagcttggcaaacatcttcggc
ctgccagtcagctccagccaggcgatagttggaggggttttgggcgttggcatcatagcg
ggagagaagatcgacaaaagggtaatcaaggacataatcttcggatgggttgcgacacca
acggtggccgttcttatatccatcattgtcttcaggctcttccacttagtcggccttgtt
tga

DBGET integrated database retrieval system