KEGG   Thermococcus guaymasensis: X802_08035Help
Entry
X802_08035        CDS       T04184                                 

Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
tgy  Thermococcus guaymasensis
Pathway
tgy00220  Arginine biosynthesis
tgy01100  Metabolic pathways
tgy01110  Biosynthesis of secondary metabolites
tgy01130  Biosynthesis of antibiotics
tgy01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tgy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    X802_08035
Enzymes [BR:tgy01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     X802_08035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: AJC72112
UniProt: A0A0X1KLH6
Position
complement(1423562..1424509)
Genome map
AA seq 315 aa AA seqDB search
MVVSLAGRDLLCLQDFTREEIETILKTAEMMKIWNKIGKPHRVLEGKTLAMIFQKPSTRT
RISFEVGIYQLGGYGLYLNANDLQLRRGETIADTARVLSRYVDGIMARVFDHKDVEDLAK
YASVPVINGLSDFSHPCQALADYQTILEKKGRIQGLKVVYVGDGNNVAHSLMIAGTKLGA
HVVVATPEGYEPEEKVIKWAEQNAAESGGSFELLHDPVQAVKDADVIYTDVWASMGQEAE
AEERRKIFMPFQVNKELVKHAKPDYIFMHCLPAHRGEEVTDDVIDSPNSVVFDQAENRLH
AQKAVMALVMGGIKV
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggtggttagccttgccggaagagaccttctctgcctccaggacttcacgagggaggag
attgagacaattctcaagaccgctgagatgatgaagatctggaacaagattggaaagcca
caccgcgttctcgagggcaagaccctcgccatgatcttccagaagccctccacaaggact
aggatttccttcgaggttgggatctaccagctcggcggatacggcctctacctcaacgcg
aacgacctccagctcaggcgcggtgagaccattgccgacacggcaagggttctcagcagg
tacgtggacggaataatggcccgcgtcttcgaccacaaggacgttgaagacctcgccaag
tacgcgagcgttcctgtcatcaatggcctttcggacttctcccacccgtgccaggcttta
gctgactaccagaccatcctcgagaagaagggcaggattcagggcctcaaggtcgtctac
gtcggtgacggaaacaacgtggctcattcgctaatgatagccggaaccaagctcggtgct
cacgtcgtagtagcaaccccagagggctacgagccggaggagaaagtcatcaagtgggct
gaacagaacgcggctgagagcggcggaagcttcgagctcctccacgacccggttcaggcc
gttaaagatgcggacgtcatctacaccgacgtctgggcgagcatgggtcaggaggccgag
gccgaggagaggagaaagatattcatgccgttccaggtcaacaaggagctcgtcaagcac
gccaagcccgactacatcttcatgcactgcctcccggcccatcgcggtgaggaggtcacc
gacgacgtcatagacagtccgaacagcgtcgtcttcgaccaggccgagaacaggctccac
gcccagaaggcggttatggccctcgttatgggcggaattaaggtctga

DBGET integrated database retrieval system