KEGG   Thermococcus guaymasensis: X802_08610Help
Entry
X802_08610        CDS       T04184                                 

Definition
(GenBank) sodium:phosphate symporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
tgy  Thermococcus guaymasensis
Brite
KEGG Orthology (KO) [BR:tgy00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    X802_08610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AJC72192
UniProt: A0A0X1KLQ6
Position
1507188..1508105
Genome map
AA seq 305 aa AA seqDB search
MLEVIATAFFMAWAIGANDSAKAVGTAVGSGIIGFKRAVLVIWIFVTMGAVLGGFGVSNT
VAGLAYGMDWPEIALVLFSAASAVTLASLWGNPISTTQAIIGALVGASLALGLPVNWGVV
TKIVLTWVISPALAGLFSIGIYRIYKRVLNRIKHLKTLELTQKWLAFVAAAYASFNLGMN
ELANVVGLAGGGPLTRVFLALSLGLGALTFSYEVMMTVGRDLAPLGPTSGFSAQMGASLA
VTLANLFGIPVSSGQAIVGAISGVSVYKGEPVNKKALRGILRGWVTAPLGAGLLAFVLVG
LFSGL
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaggtcatcgcgacagcgttcttcatggcatgggcgattggggcaaacgacagc
gcaaaggcggtaggaacggcagtcggctcggggataatcggctttaaaagggcagtcctg
gtgatctggattttcgttacgatgggggccgtgctgggaggtttcggcgtctcaaatact
gtggccgggttagcatacggtatggactggcccgagatcgcgctggttctcttcagcgca
gcctccgcggtaaccctggcaagcctctggggcaatcccatatcaacgacccaggccata
ataggggcactcgttggggcttccctggctctcggtcttccagttaactggggggtagtc
actaaaatagttctgacatgggttatctcacccgctctggccgggttgttttcaatcggt
atataccgcatttataagagggttctcaacaggataaagcacttgaaaaccctggagctg
acccagaagtggttggcctttgtggccgcggcctacgcttccttcaacctcggaatgaac
gagcttgccaacgttgttggtctggcaggcggggggcctctaacgagggtttttctggcg
ctttcccttggactgggggcgctgaccttcagctacgaggtcatgatgacggtcggcagg
gatcttgccccgctgggcccgacctcaggtttttcggcccagatgggcgcatcactggcg
gttactctggcaaacctctttggaataccagtgagctcgggccaggccattgttggggcc
atctccggggtgagcgtttacaagggggagccggttaacaaaaaggccctcagaggaatt
ttgaggggatgggtcaccgccccacttggggcaggtcttctggcttttgtgctggtgggg
ctcttttcaggtctttga

DBGET integrated database retrieval system