KEGG   Thermococcus sp. AM4: TAM4_1436Help
Entry
TAM4_1436         CDS       T01638                                 

Definition
(GenBank) Acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tha  Thermococcus sp. AM4
Pathway
tha00010  Glycolysis / Gluconeogenesis
tha00620  Pyruvate metabolism
tha00640  Propanoate metabolism
tha00680  Methane metabolism
tha00720  Carbon fixation pathways in prokaryotes
tha01100  Metabolic pathways
tha01110  Biosynthesis of secondary metabolites
tha01120  Microbial metabolism in diverse environments
tha01130  Biosynthesis of antibiotics
tha01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TAM4_1436
   00620 Pyruvate metabolism
    TAM4_1436
   00640 Propanoate metabolism
    TAM4_1436
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    TAM4_1436
   00680 Methane metabolism
    TAM4_1436
Enzymes [BR:tha01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     TAM4_1436
Lipid biosynthesis proteins [BR:tha01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   TAM4_1436
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: EEB73687
UniProt: B7R3U2
Position
complement(1624874..1626814)
Genome map
AA seq 646 aa AA seqDB search
MQIGEGFLKERYLPMKAFREEHRKSIENIEEFWAEQAKVLDWFKTWEKVLDDSKAPFFRW
FVGGQLNASYNALDRHVKAGKRNRAAIIWESERGETRTLTYYELYREVNRFASALKNLGV
EKGDRVVIYMPLVPEVVIAMLASARIGAIHSVVFSGFSAEALATRINDAKAKVVITADYL
YRRGKKLNLKEIVDKALLETPSVESVVVLRREENGVNMVEGRDYDWNELLDGAERYVEPV
PVESNHPLFILYTSGTTGKPKGIVHSTGGYLVYVAKTMEWAWGITESDLFWNTADVGWIT
GHSYLVYGPLTLGLTVMMYEGALNYPKPDRPWELVEKHGVTIFYTAPTAIRMLMRYGDEW
VKKHDLSSLRLLGSVGEPINPRAWKWYYEVVGGGRCPIIDTWWQTETGGYMIYPSAGIQL
PPLKPGSATFPGLGVDADVLRADGSLAEPNERGYLVIKKPWPGMLLGIWGDDERYIRTYW
KRFSRPDEGIWIYYPADYAMKDDEGYFWIFGRADEVLNVSGHRIGTAEIEHALVLHPAVA
EAAVIGRPDEIKGEVPVAFVILKENCVPRESLKKELIDYVRETLGPIAAPAEVFFVNKLP
KTRSGKIMRRVLKALASGKGLGDLSTLEDEASVEEVKKALEGFEMR
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgcagataggcgaaggattcctcaaggagagatacctgccgatgaaagccttcagggag
gagcacaggaagtccatagagaacatcgaggagttctgggcagagcaggcgaaggttctc
gactggttcaagacctgggagaaggtcctcgacgactcaaaggcgcccttcttccgctgg
ttcgtcggaggtcagctcaacgcgagctacaacgccctcgacaggcacgttaaggcagga
aagagaaaccgggccgcgataatctgggagagcgagcgcggtgagacgagaacgctcacc
tactacgagctctaccgcgaggtgaaccgctttgcctcggccctgaaaaacctcggcgtc
gagaagggcgacagggtcgtcatctacatgcccctcgtcccggaggttgtcatagcaatg
ctcgccagcgcgaggattggagcgattcacagcgtcgtcttctccggcttctcggcggaa
gcattagcaacgagaatcaacgacgccaaagccaaggtcgtaataacggcagactacctc
tacaggcgcggtaagaagctcaacctcaaggagatagttgacaaggccctcctcgaaacg
ccgagcgtcgaaagcgtcgtcgtcctcaggagggaggagaacggcgtcaacatggtcgag
ggcagggactacgactggaacgaactcctcgacggggccgagcgctacgttgagcccgtt
ccggtcgagagcaaccacccgttattcatcctctacacgagtggaacaaccggaaagccc
aagggaatcgtccactccaccggcggctacctcgtctacgtggcaaagacgatggagtgg
gcgtggggaataaccgagagcgacctcttctggaacaccgcagatgttggctggataacg
ggccacagttacctcgtctacgggcccttaacgctcggcctgaccgtgatgatgtacgaa
ggtgccttgaactatccaaagcccgacaggccctgggagctggtggagaagcacggggta
acgatattctacacagccccaacagcaatcagaatgctcatgcgctacggcgacgagtgg
gtgaagaagcacgacctctcaagtttaaggctcctcggttcggtcggcgagccgattaac
ccgagggcctggaagtggtactatgaagtcgttggcggtggaaggtgcccgataatcgac
acttggtggcagaccgagaccggtggctacatgatttatccctctgctgggatacagttg
cccccgcttaagcccggctcggctacttttccgggcctcggcgtcgatgctgacgttctc
agggccgatggaagtctggcggagccgaacgagcgcggttacctcgtgataaagaagccc
tggccgggaatgctcctcggaatctggggcgacgacgagcgctacattaggacctactgg
aagcgcttcagcaggcccgacgagggaatctggatttactatccagctgactatgcgatg
aaagacgacgagggctacttctggatattcggcagggccgacgaggtgcttaacgtttcg
ggccacagaattgggacggccgagatagagcatgctttggtcctccacccggcagttgcc
gaggcggcagtaatcggaaggcccgacgagattaagggcgaagtgccggtggcttttgta
atcctcaaggagaactgcgttccgagggagagcctgaagaaggaactcatagactacgtc
agggaaaccctcggaccgatagcggctccggcggaggtattcttcgtcaacaaactgccg
aagacgaggagcgggaagataatgcgtcgcgtcctaaaggccctcgccagcggaaaggga
ctcggcgacctctcaacgctggaagatgaggcgagcgtggaagaagtgaaaaaagcttta
gaaggcttcgagatgcgctga

DBGET integrated database retrieval system