KEGG   Thermococcus sp. AM4: TAM4_1982Help
Entry
TAM4_1982         CDS       T01638                                 

Definition
(GenBank) Digeranylgeranylglycerophospholipid reductase
  KO
K17830  digeranylgeranylglycerophospholipid reductase [EC:1.3.1.101 1.3.7.11]
Organism
tha  Thermococcus sp. AM4
Pathway
tha00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:tha00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    TAM4_1982
Enzymes [BR:tha01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.101  2,3-bis-O-geranylgeranyl-sn-glycerol 1-phosphate reductase [NAD(P)H]
     TAM4_1982
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.11  2,3-bis-O-geranylgeranyl-sn-glycero-phospholipid reductase
     TAM4_1982
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_3 Lycopene_cycl DAO FAD_binding_2 FAD_oxidored Trp_halogenase Pyr_redox_2 NAD_binding_8 HI0933_like 3HCDH_N Thi4 GIDA DUF596 GDI SE
Motif
Other DBs
NCBI-ProteinID: EEB73125
UniProt: B7R561
Position
complement(456668..457855)
Genome map
AA seq 395 aa AA seqDB search
MSWKYNVVVVGAGIAGPIIARNVAKAGYSVLMIDKKWAIGTPKQCAEGISIKVFEKYDIP
YDKRFINREIYGAKLYSPSGYELELRYKDVSGVILERKVFDKMLAYYAAKAGADVLARTE
ALDVIRKDGKVAGIKAKHEDEPIEIYADVIVAADGVESTIARKAGINTYAPPHEFDSSYE
YEMLIEGYDPDLIHLWFGNEIAPRGYVWVFPKDEDRANVGIGINSDNPKTAKYYLDKWLK
ENNIPAKKLLEVNVGVVPVGGFVKELVKDNVLVVGDAARQVNPMHGGGMAEAMEAGTIAS
KWIVKALEEDNLSLLQNYTKEWWETDGKRLEKVLKVRKVTEKLTDEDLDLFIQVLSGADA
EKIAGGDYVEVIKALLKHPKVLLNPRRIKLLKSLL
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgagctggaagtacaacgtcgtcgtcgttggggcgggaatagcagggcctatcatcgcc
agaaacgtcgcaaaggccggttactccgtcctcatgattgataagaagtgggcgataggc
acccccaagcagtgcgccgagggcataagcataaaggtctttgagaaatacgacatcccc
tatgataagcgcttcatcaaccgcgagatttacggagcgaaactctactccccgagcggt
tacgagctcgaactccgctacaaggacgttagcggtgttatcctcgagaggaaggtcttc
gacaagatgctcgcttactacgccgctaaggctggagcagacgtcctcgcgaggacggaa
gccctggacgtcataaggaaggacggaaaggtcgctggaatcaaggccaagcacgaggac
gagccgattgagatttacgccgacgttatcgtcgcggctgatggcgtcgagagcacgata
gcgaggaaagcgggaataaacacctacgccccgccacacgagttcgattcatcctacgaa
tacgagatgctcatagaaggctacgaccccgacctcatacacctctggttcggcaacgag
atagccccgagaggttacgtctgggtcttcccgaaggacgaggacagagccaacgtggga
attggaatcaactcggacaatccaaagaccgccaagtactacctcgacaagtggctgaag
gagaacaacatacctgccaagaagctcctcgaggtgaacgttggagtcgttcccgttgga
ggcttcgtcaaggagctcgtcaaggacaacgttctcgtcgttggcgacgcagctcgtcag
gtaaacccgatgcacggcggcggaatggcggaagcgatggaagcgggaacgatagcgagc
aagtggattgttaaggctctcgaagaggataacctctcgctcctccagaactataccaaa
gagtggtgggagaccgacggaaagaggcttgagaaggttctgaaggttagaaaggtaacg
gagaagctcacagatgaagacctcgacctcttcatacaggttctcagcggggcagacgcg
gagaagatagcaggcggagactacgtggaggtcataaaggccctcctcaagcacccgaag
gttctcctcaacccgaggaggataaagctcctcaaaagccttctctga

DBGET integrated database retrieval system