KEGG   Thermococcus sp. AM4: TAM4_546Help
Entry
TAM4_546          CDS       T01638                                 

Definition
(GenBank) Phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
tha  Thermococcus sp. AM4
Pathway
tha00010  Glycolysis / Gluconeogenesis
tha00030  Pentose phosphate pathway
tha00051  Fructose and mannose metabolism
tha00052  Galactose metabolism
tha00230  Purine metabolism
tha00500  Starch and sucrose metabolism
tha00520  Amino sugar and nucleotide sugar metabolism
tha00521  Streptomycin biosynthesis
tha01100  Metabolic pathways
tha01110  Biosynthesis of secondary metabolites
tha01120  Microbial metabolism in diverse environments
tha01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TAM4_546
   00030 Pentose phosphate pathway
    TAM4_546
   00051 Fructose and mannose metabolism
    TAM4_546
   00052 Galactose metabolism
    TAM4_546
   00500 Starch and sucrose metabolism
    TAM4_546
   00520 Amino sugar and nucleotide sugar metabolism
    TAM4_546
  Nucleotide metabolism
   00230 Purine metabolism
    TAM4_546
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    TAM4_546
Enzymes [BR:tha01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     TAM4_546
    5.4.2.8  phosphomannomutase
     TAM4_546
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV AP_endonuc_2 Nif11
Motif
Other DBs
NCBI-ProteinID: EEB74601
UniProt: B7R092
Position
complement(133385..134752)
Genome map
AA seq 455 aa AA seqDB search
MGKLFGTFGVRGIANEKITPEFALKMGMAFGTMLKREGREKPLVVVGRDTRVSGEMLKNA
LISGLLSVGCDVIDVGIAPTPAIQWATNHFKADGGAVITASHNPPEYNGIKLLEPNGMGL
KKEREAVVEEVFFKEDFDRAKWDEIGEVREENIIKPYIEAIKSRVDVEAIRKRKPFVVVD
TSNGAGSLTLPYLLRELGCKVVSVNAHPDGHFPARNPEPNEENLKDFMKIVKALGADFGV
AQDGDADRAVFIDENGRFIQGDKTFALVADAVLRENGGGLLVTTIATSNLLDDIAKRNNA
KVMRTKVGDLIVARALLEHNGTIGGEENGGVIFPDFVLGRDGAMTVAKMVEIFAKSGKKF
SELIDELPKYYQFKTKRHVEGDRKAIVEKVAELARARGYEIDTTDGTKILFPDGWVLVRA
SGTEPIIRVFSEAKSEEKAKEYLELGLKLLEEALS
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagctgttcggaaccttcggcgtccgcgggatagctaacgagaagataacgccc
gagttcgcgctcaagatgggtatggccttcgggacgatgctcaagcgcgagggaagggag
aaaccgctggtcgtcgtcggcagggacacgagggtgagcggtgagatgctgaagaacgcc
ctcatcagcggactcctcagcgttggctgtgacgtcatcgacgtgggaatagcacccacc
cctgcaatacagtgggccaccaaccacttcaaggccgacggcggggcggttataaccgct
tcccacaatccaccggagtacaacggcataaagctcctcgaaccgaacggaatgggcctc
aagaaggagcgcgaagcggtcgttgaggaggtcttctttaaggaggacttcgacagggcg
aagtgggacgaaatcggcgaggttcgcgaggagaacatcatcaagccctacatcgaggcg
ataaagagcagggtggacgttgaggcaatcaggaagagaaaaccgtttgtcgtcgttgac
acttccaacggcgccggaagcttaacactcccgtatctcctgcgcgagctcggctgtaaa
gttgtgagcgttaacgcccacccggacggtcacttcccggccagaaacccggagcctaac
gaggagaaccttaaggacttcatgaagattgtgaaggccctcggtgccgacttcggagtt
gcccaggacggcgacgctgacagggccgtcttcatagacgagaacgggcgcttcatccag
ggcgacaagaccttcgccctcgttgccgacgcggttctcagggaaaacggcggtggactg
ctcgttactaccattgcgacctcgaatctgcttgatgacatcgcgaagaggaacaacgcg
aaggtcatgagaaccaaagtcggcgacctcatcgtcgcgagggctttgctcgagcacaac
ggaaccatcggtggcgaggagaacggtggcgttatcttcccggacttcgtccttggaagg
gacggggcaatgaccgtggcaaagatggtcgagattttcgcgaagagcggaaagaagttc
agcgagctgattgatgaactgccgaagtactaccagttcaagacgaagaggcacgtggag
ggcgacaggaaggcgatagttgaaaaagtagcggagcttgcaagggcaaggggctacgag
atagacacgaccgatggaacgaagatactcttccccgacggctgggtcctcgtcagggca
agcgggaccgagccgataataagggtcttcagcgaggccaagagcgaggagaaggccaag
gagtacctcgagctcgggctgaagttgcttgaagaagctctgagctga

DBGET integrated database retrieval system