KEGG   Thalassococcus sp. S3: CFI11_03920Help
Entry
CFI11_03920       CDS       T05844                                 

Definition
(GenBank) long-chain fatty acid--CoA ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
thaa  Thalassococcus sp. S3
Pathway
thaa00061  Fatty acid biosynthesis
thaa00071  Fatty acid degradation
thaa01100  Metabolic pathways
thaa01212  Fatty acid metabolism
thaa02024  Quorum sensing
Module
thaa_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:thaa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CFI11_03920
   00071 Fatty acid degradation
    CFI11_03920
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CFI11_03920
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:thaa01004]
    CFI11_03920
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:thaa04147]
    CFI11_03920
Enzymes [BR:thaa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     CFI11_03920
Lipid biosynthesis proteins [BR:thaa01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   CFI11_03920
Exosome [BR:thaa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   CFI11_03920
  Exosomal proteins of breast cancer cells
   CFI11_03920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding
Motif
Other DBs
NCBI-ProteinID: QBF30364
UniProt: A0A4P6MG31
Position
749379..751349
Genome map
AA seq 656 aa AA seqDB search
MAQTQTGAGGVQSIPALLHRNATQHAGSPAYREKEFGIWQTWSWAETEKEIEALALGLIN
LGVNEGDFIAIIGRNRPYLYWSMVAAQSVGAVPVPLYQDAVAEEMAYVLGHCGARFVIAG
DQEQVDKVIEVQDELHQFEHMIYLDPRGLRKYDHARLHQFSHVQDQGRAAYDEFMPELQK
RREKLDYDSTCVMLYTSGTTGKPKGVVLSNRNVIETAKSSSEFDHLKVDDEILAYLPMAW
VGDFIFSIGQAYWSGFCVNCPESADTMMTDLREIGPTYYFAPPRVFETQLTNVMIRMEDA
GRFKKWLFDRYMAVARRVGPAILDGKSVGFRDRLAYALGNLFVYGPLKNTLGFSRVRVGY
TAGEAIGPEIFDFYRSLGINLKQLYGQTEATVFITAQPDGEVRSDTVGVPSPGVELRIAE
NGEVFYRSPGVFVEYYKNAESTAGTKDAEGWVATGDAGFIEEGSGHLRIIDRAKDVGKMA
DGSLFAPKYVENKLKFFPNILEAVVFGNGRSECTAFINIDLTAVGNWAERNNIAYASYQE
LAGHPQVMDTIQAHVEEVNRSVAEDEMLSGCQVYRFVVLHKELDADDGELTRTRKVRRRI
IEEKFGDIITALYDGSSQVSTTTEVTYEDGRKGSISATLEIRNAAVNSVPQRMAAE
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
ttggcccagacgcagaccggcgccggtggagtgcaatccattccggcgctccttcaccgt
aatgcgacccaacatgccggttcaccggcatatcgggaaaaggaattcggcatctggcag
acctggagctgggccgagaccgagaaagagatcgaggcgctggcgctgggcctgatcaat
ctgggtgtgaatgagggcgacttcatcgccatcatcgggcgcaaccgtccgtatctctat
tggtcgatggtcgccgcgcaatcggtgggtgccgtccccgtgccgctttatcaggacgcg
gtcgccgaggagatggcctatgtgctgggccattgcggtgcgcggtttgtcatcgccggt
gatcaggagcaggtggacaaggtgatcgaagtgcaggacgagctgcaccagttcgaacac
atgatctatctcgacccgcgcggtttgcggaaatacgaccatgcccggctgcaccagttt
tcccatgtgcaggatcaggggcgcgccgcctatgatgaattcatgccggagctgcaaaag
cggcgggagaagctggattacgacagcacctgcgtgatgctttacacctcgggtacgacg
ggcaagcccaagggtgtggtcctgtcgaaccgcaatgtgatcgagacggcgaagtcatcc
tcggaattcgaccatctgaaagtcgatgacgagatcctggcctatctgccgatggcgtgg
gtcggtgatttcatcttttccatcggtcaggcctactggagcgggttctgtgtgaattgc
ccggaaagcgcggatacgatgatgaccgatctgcgcgagatcggtccgacgtattatttc
gcgccgccgcgggtttttgagacgcaactgacaaatgtgatgatccgcatggaagatgcg
ggacggttcaagaaatggctctttgatcgctacatggccgtcgcacgccgtgtggggcct
gccatcctggacggtaaatcggtggggttcagggatcgtcttgcctatgcgctgggcaac
ctctttgtctacggaccgctgaagaacacgctggggttcagccgcgtgcgcgtggggtat
accgcgggcgaggcgatcgggcctgagatcttcgatttctaccgatcgctggggatcaac
ctgaaacagctttacgggcagacggaggccacggtcttcatcaccgcgcagccggatgga
gaggtgcggtccgacaccgtgggcgtgccctcccccggggtggagttgcgcatcgcggag
aacggcgaggtgttctaccgctcaccgggtgtcttcgtggagtattacaagaacgccgaa
agcaccgcaggcaccaaggatgccgagggctgggtcgccacgggcgatgcgggctttatc
gaggagggctcgggccatttgcggatcatcgaccgggccaaggatgtgggcaagatggcc
gatggcagcctctttgcgccgaaatatgtcgagaacaagttgaagttctttcccaacatt
ctggaggcggtggtcttcgggaacgggcgcagcgaatgcacggcgttcatcaatattgac
ctgacggcggtgggcaactgggcggagcggaacaatatcgcttacgcctcttaccaggag
ctggcggggcatccgcaggtgatggacacgatccaggcccacgtggaggaggtgaaccgc
tcggtcgcggaagacgagatgctctcgggctgccaggtgtatcgctttgtggtgctgcac
aaggagctggatgcggatgacggggagctgacacgcacgcggaaggtgcgccgccggatc
attgaggaaaagttcggagatatcatcacggcactttatgacgggtcgtcgcaggtgagt
acgacgacggaagtgacctatgaagacgggcgcaaggggtcgatcagtgcgacgctggag
atccggaatgcggcggtcaattcggtgccgcagaggatggcagcggaatga

DBGET integrated database retrieval system