KEGG   Thalassococcus sp. S3: CFI11_07950Help
Entry
CFI11_07950       CDS       T05844                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
thaa  Thalassococcus sp. S3
Pathway
thaa00450  Selenocompound metabolism
thaa00970  Aminoacyl-tRNA biosynthesis
thaa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thaa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CFI11_07950
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CFI11_07950
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:thaa01007]
    CFI11_07950
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:thaa03016]
    CFI11_07950
Enzymes [BR:thaa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CFI11_07950
Amino acid related enzymes [BR:thaa01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CFI11_07950
Transfer RNA biogenesis [BR:thaa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CFI11_07950
 Prokaryotic type
   Other AARSs
    CFI11_07950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 Anticodon_1
Motif
Other DBs
NCBI-ProteinID: QBF31151
UniProt: A0A4P6MIK8
Position
complement(1582338..1584047)
Genome map
AA seq 569 aa AA seqDB search
MARHLITSAIPYINGIKHLGNLVGSQLPADLYARYNRARGHEVLFLCATDEHGTPAELAA
AKAGKPVAEYCAEMHAIQSELAKGFRLSFDHFGRSSSPQNHALTQHFAGKLAEAGLIREV
SEKQVYSNADGRFLPDRYIEGTCPNCGYDKARGDQCENCTIQLEPTDLIDPRSAISGSTD
LEVRETKHLYLRQSALKDDLDAWIDSKTDWPVLTTSIAKKWLHDGDGLKDRGITRDLDWG
IPVKRGDDDWPGMEEKVFYVWFDAPIEYIACASEWAEATGGDWERWWRTDKGADDVRYTQ
FMGKDNVPFHTLSFPATILGSGEPWKMVDHLKSFNYLNYDGGQFSTSQGRGIFMDQALEI
LPADYWRWWLLSHAPENSDSEFTWENFQVSVNKDLADVLGNFVSRITKFCRSKFSEAVPE
DGTYGPDEAALIDALTTRIRAYEAHMDAMEIRKSATELRAIWVAGNEYLQNTAPWTTYKS
YPAKAAAQVRLGLNLIRLYAVLSAPFIPDASARMLTAMNASDATWPDDVPAALSALPGGH
GFAVPDVLFAKITDEAQEDWQARFSGIRG
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atggcacgacatctcatcacttcggcgatcccgtatatcaacgggatcaagcatctgggc
aatctggtcggctcccagcttcccgccgatctctatgcccgctacaaccgcgcgcgcggc
cacgaggttctgtttctctgtgccaccgacgagcatggcacaccggccgagctggccgcc
gccaaggcaggcaaacccgtggccgaatattgcgccgagatgcatgccatccagtccgaa
ttggccaagggcttccgcctcagcttcgatcatttcggtcgctcctcttcgccccagaac
cacgcgctgacccaacatttcgcaggaaagctggctgaggccgggctgatccgcgaagtg
tccgaaaagcaggtctattccaatgccgacggacgcttcctgcctgaccggtatatcgaa
gggacctgccccaattgcggctatgacaaggcgcgcggcgatcaatgcgagaattgcacc
atccagcttgagccgaccgacttgatcgacccacgctcggccatctccggctccaccgat
ctcgaagtgcgcgagaccaaacatctctatctgcgccaatccgccctgaaagacgatctc
gacgcctggatcgacagcaagaccgactggccggtcctgacgacctccatcgccaagaag
tggctccatgacggcgacgggctgaaagatcgcggcatcacccgcgatctcgattggggc
attccggtcaaacgcggcgacgacgactggcccggcatggaggagaaggtcttttatgtc
tggttcgacgcgcccatcgaatacatcgcctgcgccagcgaatgggccgaggcgacaggc
ggtgactgggaacgctggtggcgcaccgacaagggcgcggacgatgtgcgctacacccag
ttcatgggcaaggataacgtgccctttcacacgctcagcttcccggccacgatcctgggc
tcgggcgagccctggaagatggtcgatcacctgaaatccttcaattacctgaattatgat
ggcggccagttctcgacctcgcaggggcgtggcatcttcatggaccaggcgctggagatt
ctgcccgccgattactggcgctggtggcttctgagccatgcgcccgaaaattcggatagc
gaattcacctgggagaacttccaggtctccgtgaacaaggatcttgcggacgttctgggc
aatttcgtcagccgtatcacaaagttctgccgctcgaaatttagcgaggccgtccccgag
gacggcacgtacgggccggacgaggccgcgcttatcgatgcgctcacaacccgcatccgg
gcgtacgaggcacatatggatgccatggaaatccgcaaatccgccaccgagctgcgcgcg
atctgggtggccgggaacgaatatctgcagaacaccgccccctggacgacttacaagagc
tatcccgcgaaagcggccgctcaggtgcgcctgggcttgaacctgatccgcctttacgcg
gtcctcagcgctccttttatccctgacgcaagcgcccggatgctgaccgcgatgaatgca
agcgacgcgacctggcccgacgacgtgcccgcggcgttgtccgcgctgcccggcggacac
gggtttgcggtgcccgatgtgctctttgccaagatcacggatgaggcgcaagaggattgg
caggcacggttctccggcatccgggggtag

DBGET integrated database retrieval system