KEGG   Thalassococcus sp. S3: CFI11_08600Help
Entry
CFI11_08600       CDS       T05844                                 

Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
thaa  Thalassococcus sp. S3
Pathway
thaa00970  Aminoacyl-tRNA biosynthesis
thaa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thaa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CFI11_08600
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:thaa03029]
    CFI11_08600
Enzymes [BR:thaa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     CFI11_08600
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     CFI11_08600
Mitochondrial biogenesis [BR:thaa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CFI11_08600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: QBF31275
Position
complement(1728828..1730339)
Genome map
AA seq 503 aa AA seqDB search
MLDLTFEPPKVKTIAGAKQDWELVIGMEVHAQVSSNAKLFSGASTAFGAEPNSNVSFVDA
AMPGMLPVINEYCVEQAVRTGLGLKAEINLRSAFDRKNYFYPDLPQGYQISQLYHPIVGE
GEVIVEMGEGIARRVRIERIHLEQDAGKSIHDMDPAMSFVDLNRTGVALMEIVSRPDIRG
PEEAAAYIAKLRQILRYLGTCDGNMQNGNLRADVNVSICEPGAYERYQETQDFSHLGTRC
EIKNMNSMRFIQQAIDVEARRQIAIVEAGGKVEQETRLYDPDKGETRSMRSKEEAHDYRY
FPDPDLLPLEIEQAWVDDIETSLPELPDEKKARFINDFSLSDYDASVLTAEVESAAYFEA
VAEGRDGKLAANWVINELFGRLKKEDHDITESPISPTQLGQIIELIQKGDISGKIAKDVF
EIAYTSGREPSEIVETEGMKQVTDTGAIEAAVDQVIADNPAQVEKAKQNPKLAGWFVGQV
MKATGGKANPKAVNEIVSAKLGL
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgctggacctgacgttcgagcccccgaaggtgaaaacgattgccggagccaaacaggac
tgggaattggtcatcgggatggaggtgcacgcccaggtcagttccaacgccaagctcttt
tcgggcgcgtcgaccgcgttcggggcagagccgaattccaacgtctctttcgtggacgcc
gcgatgccgggcatgctgccggtcatcaacgaatattgtgtcgaacaggcggtgcgcacc
gggctgggtctgaaggccgagatcaacctgcgcagcgcgttcgaccgcaagaactatttc
tacccggatctgccgcagggctaccagatcagtcagctttaccaccccatcgtgggtgaa
ggcgaagtcatcgtcgagatgggcgaaggcatcgcccgccgcgtacggatcgagcgtatt
cacctggaacaggatgcgggcaagtcgatccacgacatggacccggcgatgtcctttgtg
gaccttaaccgcacgggcgtggcgctgatggagatcgtctcgaggccggacatccgcggc
cccgaagaggccgccgcgtatattgccaagctgcgccagatcctgcgctatttgggcacc
tgcgacggtaacatgcagaacggcaacctgcgcgcggacgtgaacgtgtcgatctgcgag
ccaggcgcctatgagcgctatcaggagacgcaggacttctcccatctggggacgcgctgc
gagatcaagaacatgaactccatgcggttcattcagcaggccatcgacgtcgaggcccgc
cgccagatcgccattgtcgaagccggcggcaaggtggagcaggaaacccggctctatgac
cctgacaagggcgagacccggtcgatgcggtccaaggaagaggcgcacgattaccgctat
ttccccgacccggatctgctgccgctggagatcgaacaggcctgggtggatgatatcgag
accagcctgccggaattgccggacgagaagaaagcgcgctttatcaatgatttcagcctc
tcggactatgatgcgtcggtgctgacggcagaggttgagtcagccgcttatttcgaggcc
gtggccgagggacgcgacggaaagctcgccgccaattgggtcatcaacgaacttttcggg
cggctgaaaaaggaagatcacgacatcaccgaaagccccatcagccccacgcaactgggc
cagatcatcgaattgatccagaagggcgatatcagcggcaagatcgcaaaggacgtcttt
gaaatcgcttatacgtcgggacgtgagccgtcagagatcgtcgaaaccgaaggcatgaag
caggtcaccgataccggcgcgatcgaggccgcggtggatcaggtgatcgccgacaacccc
gctcaggtggaaaaggccaagcaaaacccgaaactggcgggctggttcgtgggtcaggtc
atgaaggcaacgggcggcaaggccaacccgaaggccgtgaacgagatcgtgagcgcaaag
ctgggcctttga

DBGET integrated database retrieval system