KEGG   Thalassospira marina: CSC3H3_00805Help
Entry
CSC3H3_00805      CDS       T05224                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
thac  Thalassospira marina
Brite
KEGG Orthology (KO) [BR:thac00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    CSC3H3_00805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: AUG51417
UniProt: A0A2N3KSF3
Position
181774..182166
Genome map
AA seq 130 aa AA seqDB search
MYKAVTHNIRVSVKPTFLDEQSDPDRHRYVWAYRVLIENQGADAVKLLRRHWKITDSRGA
TQTVDGDGVVGEQPVIAAGASFKYTSGAPLSTPGGFMVGHYVMEDLDGNEFNIDIPAFSL
DSPHSVVTLN
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtataaggctgtaacacataacatcagggtgtcggtaaagccgacttttcttgatgaa
cagtcagacccggatcggcatcgctatgtctgggcttatcgtgtgttgattgaaaatcag
ggtgccgatgcggtcaaattgctgcgccgacactggaaaattaccgattcacgcggggca
acccagaccgtggatggcgatggtgtcgtaggtgaacaacccgtaatcgcggcgggcgcc
agcttcaaatataccagtggtgcacccctgtcgacgccgggcgggtttatggttggtcat
tacgttatggaagacctcgatgggaacgagtttaacattgatattcctgccttctcgctc
gatagtccgcacagtgttgtcacgttgaactaa

DBGET integrated database retrieval system