KEGG   Thalassospira marina: CSC3H3_08620Help
Entry
CSC3H3_08620      CDS       T05224                                 

Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
thac  Thalassospira marina
Pathway
thac00970  Aminoacyl-tRNA biosynthesis
thac01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thac00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CSC3H3_08620
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:thac03029]
    CSC3H3_08620
Enzymes [BR:thac01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     CSC3H3_08620
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     CSC3H3_08620
Mitochondrial biogenesis [BR:thac03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CSC3H3_08620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-ProteinID: AUG52764
UniProt: A0A2N3KVD3
Position
1898207..1898497
Genome map
AA seq 96 aa AA seqDB search
MSSLDKETVRKIAFLSRINVSEEGLSELAGDLTRILDFVEELQEVDVEGCDPLTSVADLT
LPLRKDEVTDGNIQQKVLANAPMTDAGCFVVPKVVE
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctttggataaggaaacagttcgcaaaatcgcatttctgtcacgtatcaacgtg
tccgaggaaggcctgagcgaactggcgggagatctgacccgtatcctcgattttgttgag
gaactgcaagaagttgatgtcgagggctgtgacccgctgacgtcggttgccgatctgacc
ctgccgctgcgcaaggacgaagtcaccgatggcaatatccagcaaaaggtgcttgcaaat
gcacccatgaccgatgctggctgttttgttgtgccgaaggtggttgaataa

DBGET integrated database retrieval system