KEGG   Thalassospira marina: CSC3H3_08775Help
Entry
CSC3H3_08775      CDS       T05224                                 

Definition
(GenBank) multifunctional 2',3'-cyclic-nucleotide 2'-phosphodiesterase/5'-nucleotidase/3'-nucleotidase
  KO
K11751  5'-nucleotidase / UDP-sugar diphosphatase [EC:3.1.3.5 3.6.1.45]
Organism
thac  Thalassospira marina
Pathway
thac00230  Purine metabolism
thac00240  Pyrimidine metabolism
thac00760  Nicotinate and nicotinamide metabolism
thac01100  Metabolic pathways
thac01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:thac00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CSC3H3_08775
   00240 Pyrimidine metabolism
    CSC3H3_08775
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    CSC3H3_08775
Enzymes [BR:thac01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     CSC3H3_08775
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.45  UDP-sugar diphosphatase
     CSC3H3_08775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 5_nucleotid_C Metallophos YmdB
Motif
Other DBs
NCBI-ProteinID: AUG52791
Position
complement(1929504..1931099)
Genome map
AA seq 531 aa AA seqDB search
MKRMTLGLLTACSMLALGGAPALADYQLRILHTNDVHDRVESVTKYNNSCDAKGETEGKC
FGGYARLATAIRDARAQGGNTVVLDAGDQFQGSLFYTTYKGDLTAELMGMVGYDAMTIGN
HEFDDGPENLVRFIENNKTPIVSSNLVAGPASPLHDKVKPYTILEAGGQKIGVIGLTTEE
TPEVSSIGPDLTFMKSEEALRIAVAKLKLEGIDKIIVLGHDGSYRDFEIAKRVDGIDVIV
GGHDHLLFSNTDKNAQYPYPVVEHTPNGDPVLIVQAYAYSRYLGDLNVTFNDDGVPVKWQ
GDPIALDSSVKQAPDVLAAIDAKRAPVDAVRNQLVGEFSGPADGSRETCRAQECAMGDLV
ADAMLAKAGEGFQIAIQNGGGLRASIDQGQVNMGEVMTVLPFQNTIATFKLSGKNVVASL
EHGVSGVAEGKGQFPQVAGLKFDLDLAAAEGARVSNVMVMEDGAYSPIQDDKLYGVVSND
FMRRGGDGYVLFRDNGVDAYDYGPNLEDAVAEYIAANSPMTPATQGRIILK
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggatgacgttgggcctgctgactgcctgttcgatgctggcccttgggggcgca
cccgctcttgctgattatcaactgcgaattttacacaccaacgacgttcatgaccgggtc
gaatcggtcaccaaatataacaatagctgcgatgccaaaggcgaaaccgaaggcaaatgt
tttggcggctatgcccgcctggcaaccgccattcgcgatgcccgcgcccaaggtggtaac
acggtggttcttgatgcgggcgaccagtttcagggatcgcttttctataccacctataaa
ggtgacctgactgccgaactgatgggcatggttggctatgacgccatgacgatcggcaac
catgaatttgatgacggaccggaaaatctggtccgtttcattgaaaataacaaaacccct
atcgtatcaagcaatctggtcgcaggtcctgcatcccccctacatgacaaggtaaaaccc
tataccattctggaagccggcgggcagaaaatcggcgtgattggcctcacgaccgaggag
acaccggaagtcagctctatcggcccggatctgaccttcatgaaatcggaagaggcattg
cgcatcgctgttgccaagctgaagcttgaaggcatcgacaagatcattgttctgggacat
gacgggtcctatcgcgattttgaaattgccaagcgcgtagatggcatcgacgttattgtt
ggcgggcatgaccacctgctgttttccaataccgacaaaaacgcccaatacccctacccg
gttgtagaacacacccccaacggcgaccctgtgctgatcgtacaggcctatgcctatagc
cgttatcttggcgatctgaacgtcacctttaatgacgatggtgtgccggtcaaatggcag
ggtgatcctattgcacttgatagcagcgtcaaacaggcacccgatgttctggccgctatt
gatgccaaacgcgccccggtggatgccgtgcgcaaccagcttgttggcgaattttcagga
ccagccgacggatcgcgtgaaacctgccgtgcgcaggaatgtgcgatgggcgaccttgtt
gccgatgcgatgctggcaaaggccggcgaaggcttccagatcgccattcaaaatggtggc
ggcctgcgtgccagcattgatcagggccaggtcaatatgggtgaggtcatgaccgttctg
ccgttccagaacacgattgcgaccttcaaactttcgggcaagaacgtggttgcatcgctt
gaacatggggtttctggcgtggccgaaggcaaaggccagttcccgcaggttgccggactg
aaatttgaccttgatctggctgcggctgaaggtgcgcgtgtttcaaacgtcatggttatg
gaagatggcgcttacagcccgatccaggacgacaaattatacggtgttgtctcgaacgat
ttcatgcgtcgtggtggcgatggctacgttttgttccgcgacaatggtgttgatgcctat
gattatggccccaatcttgaagatgcggttgccgaatatatcgcggcaaattcgccgatg
accccggccacacagggccgcatcatcctgaaatag

DBGET integrated database retrieval system