KEGG   Thalassospira marina: CSC3H3_13240Help
Entry
CSC3H3_13240      CDS       T05224                                 

Definition
(GenBank) amidohydrolase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
thac  Thalassospira marina
Brite
KEGG Orthology (KO) [BR:thac00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CSC3H3_13240
Enzymes [BR:thac01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     CSC3H3_13240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: AUG53573
Position
complement(2909787..2910614)
Genome map
AA seq 275 aa AA seqDB search
MTRFIAACVQVNSRDNMDDNLARAAIYARDAHAAGARLISFPENVSMMSFGGEKVRAAAF
AEDAHPALAFFRDLAAELESTLVVGSLHVSVPGEDRVANRCYVIGPDGQVMTSYDKIHMF
DVDLANGESYRESKTFRPGDAARLVETAQAKIGLAICYDVRFPHLFRDYAKAGATVLTVP
AAFTRTTGQAHWHTLLRARAIETGCFVIAAAQCGDHPGDRQTFGHSLIIDPWGVVLADGG
AEPGFITAEIDLERVNEVRAMVPSLRNDHPYSPAG
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgacccgttttattgctgcctgtgtgcaggtaaatagccgcgataacatggatgacaat
ctggcgcgtgccgcaatttatgcccgcgatgcccatgctgccggtgcccggctgatcagt
tttcccgaaaatgtgtcgatgatgtcctttggcggggaaaaggtgcgtgccgccgccttt
gccgaagatgcccacccggcgctggcgtttttccgggatttggctgctgaacttgaaagc
acgctggttgtgggatcattgcatgtcagcgtgccgggcgaagaccgcgttgccaaccgc
tgttatgtgattggcccggacgggcaggtgatgacgtcgtacgataaaatccacatgttt
gatgtggaccttgccaatggggaatcgtatcgcgaaagcaaaactttccgccccggcgat
gctgcccggctggtggaaaccgcacaggccaaaatcggcctggcgatttgttatgatgtg
cgtttccctcacctgtttcgtgattatgccaaagccggtgcgacggttttgacggtgcct
gcagcctttacccgcacaaccgggcaggcgcactggcatacattgttgcgtgcgcgtgcc
attgaaaccggctgttttgttattgcggcggcccagtgtggcgaccatcccggcgaccgg
cagacatttggccattccctgatcattgacccgtggggcgttgtcctggccgatggcggt
gccgaaccgggctttatcaccgccgagatcgacctggaacgtgtcaatgaagtgcgcgcg
atggtgccatccttgcgcaatgatcatccctatagcccggcgggttaa

DBGET integrated database retrieval system