KEGG   Thalassospira marina: CSC3H3_20220Help
Entry
CSC3H3_20220      CDS       T05224                                 

Definition
(GenBank) cobyric acid synthase
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
thac  Thalassospira marina
Pathway
thac00860  Porphyrin and chlorophyll metabolism
thac01100  Metabolic pathways
Module
thac_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:thac00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CSC3H3_20220
Enzymes [BR:thac01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     CSC3H3_20220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26
Motif
Other DBs
NCBI-ProteinID: AUG55257
Position
4452819..4454399
Genome map
AA seq 526 aa AA seqDB search
MLQGTGSDVGKSLLVAGLCRAFAHRGLRVRPFKPQNMSNNAAVTADGGEIGRAQALQARA
AGVETTVHMNPVLLKPQSEIGAQVVVQGQVLTSAKARDYYRLKRDLLPRVIESFEIIAAD
ADLVIVEGAGSPAEVNLRAADIANMGFAEATQMPVVLVGDIDRGGVIASIVGTHNLLSES
DRQWLKGYVINKFRGDVSLFESALEIIEDHTGLKSFGIATFWPDAAKLPPEDGVALGQAE
RYRKSLRRPVTGRNVGDTGDVEGSKPEGAPAQPLLRVAVPHYPQIANFDDLDPLLAEPGI
DLMLVKPGEVIPAGCDLVVLPGSKSTLSDLRFLKAQGWDSDIIAHWRNGGHVMGICGGYQ
MLGTCVSDPNGVEGEPGDEAGLGLLDVQTVMEGRKTLRQSQAHVAGNALCPVADGTALGG
YEIHMGQTTGPDRKAGWVATPENEDADGAIGGQGRVMGCYLHGLFTSDDFRRAYLAAISG
QGPWDQNVAFEAGIDATLDGLAAHLEQCLDLDALWALAKTRNNPMI
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgttgcagggcaccgggtcggatgtggggaaatcgcttctggtggcgggcctgtgccgg
gcatttgcccaccgtggcctgcgggtgcgcccgtttaaaccgcaaaatatgtccaataac
gccgccgtcacggccgatggcggcgaaattggccgggcgcaggccttgcaggcgcgggcc
gctggggtggaaaccacggtgcatatgaacccggttctgttaaagccgcaaagcgaaatt
ggtgcgcaggtggtggtgcagggccaggtcctgaccagtgccaaagcgcgcgattattac
cgcctgaaacgcgaccttctgccgcgcgtgattgaaagttttgagatcattgcggcggat
gccgaccttgttatcgtcgaaggggcggggtcaccggcagaagtgaatttgcgggctgcc
gacattgccaatatgggctttgccgaagccacccaaatgccggttgtgctggttggcgat
attgaccggggcggggtgattgcctcgatcgtggggacacataacctgctgtctgaaagc
gaccggcagtggctgaagggctatgtgatcaacaagtttcgcggtgatgtatcgctgttt
gaatcggcgttggagattatcgaagatcataccggccttaaaagttttggtatcgcaacg
ttttggccggatgcggcaaagctgccgcccgaagatggcgtggcattgggccaggcggaa
cgttaccgtaaatccctgcggcgcccggtaacgggcaggaatgttggggatacgggcgat
gttgagggaagcaagccggaaggggcaccagcgcaacccctgcttcgcgtggcggtgccg
cattatccgcagattgccaattttgatgaccttgaccccctgctggccgaaccgggcatt
gatttgatgctggttaaacccggcgaggtcataccggcgggatgtgatttggtggtgttg
cccggcagcaaatcgaccctgtcggatttgcggtttttaaaggcgcagggctgggatagc
gacattatcgcccactggcgcaatggcggccatgtgatgggcatttgcggtggctatcag
atgctgggtacctgtgtttctgaccccaacggggttgagggggagccgggtgatgaagcc
gggcttggcctgctggatgtgcaaaccgtgatggaagggcgcaaaaccctgcgccaaagc
caggcccatgtggcgggcaacgccctgtgcccggtggccgatggcacggcccttggcggt
tatgaaatccatatggggcaaaccaccgggccggaccgcaaggctggctgggttgccacc
ccggaaaatgaagatgcggatggtgccattggcgggcagggccgggtgatgggatgctat
ttgcatggcctgtttaccagcgatgattttcgccgggcctatcttgcggcgatcagcggg
caggggccgtgggaccagaatgttgcctttgaggccggcattgatgcaacgctggacggg
ctggcggcccatcttgaacagtgccttgatctggacgccctgtgggcgctggcaaaaaca
cgtaataatccgatgatttaa

DBGET integrated database retrieval system