KEGG   Thalassospira marina: CSC3H3_23440Help
Entry
CSC3H3_23440      CDS       T05224                                 

Definition
(GenBank) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
thac  Thalassospira marina
Pathway
thac00130  Ubiquinone and other terpenoid-quinone biosynthesis
thac00627  Aminobenzoate degradation
thac01100  Metabolic pathways
thac01110  Biosynthesis of secondary metabolites
thac01120  Microbial metabolism in diverse environments
thac01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:thac00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    CSC3H3_23440
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    CSC3H3_23440
Enzymes [BR:thac01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     CSC3H3_23440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: AUG55795
UniProt: A0A2N3KTI2
Position
pCSC3H3:735709..736290
Genome map
AA seq 193 aa AA seqDB search
MKRVIIAITGASGVIYGVRALQLLRDVADIETHAVISPSALRTARAELDMDADEIRSYAD
VIYNYRDIGAAISSGSFQTAGMLVAPCSIKTLSGIANCYNDELIVRAADVCLKERRRVVL
LLRETPYHAGHINLMAQATQNGAIIMPPVPAFYSRPQSIDEMVTQTTGRALDLLGIHLPV
VKRWTENGEQAED
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgggttatcatcgccattaccggggcatcgggcgttatttatggtgtgcgcgcc
ctgcagcttttgcgcgatgtcgccgatattgaaacccacgctgtaatttcaccttcggcc
ctgcgtaccgcgcgcgccgaactggatatggatgccgatgaaatccggtcctatgccgat
gtcatctataattatcgcgatatcggtgctgccatttcatctggttcattccagacggca
ggcatgctggttgccccctgttcgatcaaaacccttagcggcatcgccaattgctacaat
gatgaactgattgtccgtgctgccgatgtctgcctgaaggaacgccgccgtgtggtgctg
ttattgcgtgaaacgccctatcatgccggccatatcaacctgatggcccaggcgacgcaa
aatggcgccatcatcatgccccccgtcccggccttttacagccgcccgcaaagcattgat
gaaatggttacgcaaaccaccggccgcgcgctggaccttctgggcatccatttgccggtt
gtcaaacgctggacagaaaatggggaacaggccgaagattga

DBGET integrated database retrieval system