KEGG   Candidatus Endolissoclinum faulkneri L2: A1OE_1036Help
Entry
A1OE_1036         CDS       T02365                                 

Gene name
proB
Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
thal  Candidatus Endolissoclinum faulkneri L2
Pathway
thal00330  Arginine and proline metabolism
thal00332  Carbapenem biosynthesis
thal01100  Metabolic pathways
thal01130  Biosynthesis of antibiotics
thal01230  Biosynthesis of amino acids
Module
thal_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:thal00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    A1OE_1036 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    A1OE_1036 (proB)
Enzymes [BR:thal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     A1OE_1036 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA Nitro_FeMo-Co
Motif
Other DBs
NCBI-ProteinID: AFX99215
UniProt: K7YHZ1
Position
complement(956335..957501)
Genome map
AA seq 388 aa AA seqDB search
MNSAPIMNITASDHRIYRSRRIVIKIGSAVLIDKKSGLVRTAWMESLAADVNRLRHAGIE
VLIVSSGAVALGCHRLRINHIRSKLKARRPTSAIGQIMLAHAYQEVMFHNGITTAQILLS
TDDTEQRRPHLYLRSTINDLLKLGVVPVINENDTVSTTSCSFGDNDRLSARIAQVANADT
LIILSDIDGLYTSDPRCNAAARHIPEVKYVTAEIEAMAGNAGSSYTSGGMVTKLAAAKIA
AAAGCQTVIANGLEPNPIYRIDSAGSCTWFCEVASSLTTRKRWIASSLDPRGQLILNSGA
LQALIAGKSLLPAGVIEVIGTFERGDVVTLHAPDRALCGRGLITYASHDAKQIAGLKSRE
IETTLGYHRSDEIVHRNDLVLNECSIPK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaacagtgcccccataatgaacatcactgcctctgatcacaggatttatagatctcgt
aggatagtgatcaaaattggctcagctgtactaatagataagaaaagtggcttagtccgt
acggcctggatggaatctttggcagctgatgttaatcgcctgcgacatgcggggatagag
gtcttgattgtttcttccggagctgtggctctcggctgccatcgattacgtattaatcac
attcgatcaaagcttaaagcaaggcgacctacttctgccatcggccaaattatgttggct
catgcctatcaagaagtaatgtttcataatggtataactacagcgcaaattttgctttct
acggatgataccgaacagaggcggcctcatttatatcttcgttccaccataaatgatttg
ctgaaacttggggtagtgccggtgatcaatgaaaatgacacagtatcgaccactagttgc
agctttggcgacaatgataggctcagcgcaagaatagctcaggtggcaaacgccgatact
ctaattattttatcagatatagatggtttatatacttctgatcctcgctgcaatgctgct
gctcgtcatataccagaggtcaagtatgtaaccgctgagatcgaagcaatggctggtaat
gcgggtagtagctacacatctggtggtatggttactaagcttgccgccgctaaaatagct
gctgctgcaggctgtcaaacggttatagctaacggattggaaccaaacccaatttatcgc
attgatagtgcaggaagttgcacttggttttgtgaggttgcttcctctttgactactcgt
aaacgctggattgctagttcgcttgatcctcgtggtcagcttattcttaattctggcgca
ctacaagcgctaattgctggcaaaagcttattacctgctggagtaattgaggtaattggt
acttttgaaagaggtgacgtagtaacattacatgcgcctgatcgtgcattatgcggtcgt
ggtctaataacttatgcctctcatgatgcaaaacaaattgctggactgaaatctcgtgaa
atagaaactacccttggttaccatcgctcagatgaaatcgttcatagaaatgatcttgta
ttaaatgaatgcagcattcctaagtag

DBGET integrated database retrieval system