KEGG   Candidatus Endolissoclinum faulkneri L2: A1OE_231Help
Entry
A1OE_231          CDS       T02365                                 

Gene name
rplV
Definition
(GenBank) Ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
thal  Candidatus Endolissoclinum faulkneri L2
Pathway
thal03010  Ribosome
Brite
KEGG Orthology (KO) [BR:thal00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    A1OE_231 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:thal03011]
    A1OE_231 (rplV)
Ribosome [BR:thal03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    A1OE_231 (rplV)
  Bacteria
    A1OE_231 (rplV)
  Archaea
    A1OE_231 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AFX98433
UniProt: K7Z3B1
Position
complement(217531..217920)
Genome map
AA seq 129 aa AA seqDB search
MGKRMFGRRIDNRDAKAILRNARVSVQKLNLIAQMIRGQRANNALATLAFSKRQIARDVR
KLLESAIANAENNHQLDVDRLFVKEAFVGKSITIKRFRPRARGLLGRIKRPFSHMTVILS
ERREQTNGS
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
gtgggtaaaagaatgtttgggagacgcattgacaatagagatgctaaggctattctgcgc
aatgcacgtgttagtgtgcagaaattaaatttgattgcacaaatgattcgtggccagcgt
gcaaacaatgccttagctactttagccttttccaagcgccaaattgcacgtgacgtgaga
aagcttttggaatctgctattgctaatgctgaaaataaccaccaacttgatgtcgatagg
ctttttgttaaggaagcttttgtaggcaagagcataacaataaagcgctttcgtcctaga
gcacgtggattgttaggtcgaattaaaaggccatttagtcacatgactgtaatcttaagt
gagcgtagggagcaaactaatgggtcataa

DBGET integrated database retrieval system