KEGG   Candidatus Endolissoclinum faulkneri L2: A1OE_793Help
Entry
A1OE_793          CDS       T02365                                 

Definition
(GenBank) hypothetical protein
  KO
K06195  ApaG protein
Organism
thal  Candidatus Endolissoclinum faulkneri L2
Brite
KEGG Orthology (KO) [BR:thal00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    A1OE_793
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354 DUF4873
Motif
Other DBs
NCBI-ProteinID: AFX98978
UniProt: K7Z4Q1
Position
complement(738338..738841)
Genome map
AA seq 167 aa AA seqDB search
MCNKVNVLNKYIKIYNFYIFKCQLNLLNTFNKNTGLAMYSKTTRNIHVTVISVYLDGYSS
PSNNHYVWAYRVKIKNSSKEIVRITKRHWQIIDSTGIIREISGIGVVGNQPILKPEEHFE
YTSACPLTTPSGIMVGSYTMETNEGIIFKVSIPAFSLDSPHDTIQIN
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
ttgtgtaataaggtaaatgtattaaataaatatataaaaatttacaatttttatatattt
aagtgccaacttaatctattaaatacttttaataaaaatacagggttggcgatgtacagc
aagactacacgcaacatccatgtgacagtaatttcggtatatcttgatggatactccagc
ccgtcgaataatcactatgtttgggcttatagagtaaaaatcaaaaatagcagcaaagaa
atcgttcgcataacaaaacgtcattggcaaatcatagattctactggaattatccgagaa
ataagtggtataggggttgtaggaaatcagcctatacttaagccagaagagcattttgag
tatactagcgcctgtccattaactactccatcaggaataatggtaggtagctacaccatg
gaaaccaatgaagggataatatttaaagtatctattccagccttttctctcgacagtcca
cacgatacaatccaaatcaactaa

DBGET integrated database retrieval system