KEGG   Candidatus Endolissoclinum faulkneri L2: A1OE_96Help
Entry
A1OE_96           CDS       T02365                                 

Gene name
cysS
Definition
(GenBank) cysteinyl-tRNA synthetase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
thal  Candidatus Endolissoclinum faulkneri L2
Pathway
thal00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:thal00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    A1OE_96 (cysS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:thal01007]
    A1OE_96 (cysS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:thal03016]
    A1OE_96 (cysS)
Enzymes [BR:thal01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     A1OE_96 (cysS)
Amino acid related enzymes [BR:thal01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   A1OE_96 (cysS)
Transfer RNA biogenesis [BR:thal03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    A1OE_96 (cysS)
 Prokaryotic type
    A1OE_96 (cysS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e DALR_2 tRNA-synt_1g tRNA-synt_1
Motif
Other DBs
NCBI-ProteinID: AFX98307
UniProt: K7YLE0
Position
complement(88792..90228)
Genome map
AA seq 478 aa AA seqDB search
MRAPTYPPGIQDMKLKITNTLMRKKQVFHTIDPLNVRVYVCGPTVYDYAHVGNARPAVVF
DVLVRLLRHIYGEAHVTYVTNITDVDDKIINRSKELGITMEVLTREITNIYKADMDAIGV
NKPNVQPRATEHIGAMIALTQRLINLRHAYITNNHVLFNVHSAANYGQLSRRYEQEFIAE
SRIDLVSFKRNPSDFVLWKPTANDQQGWDSPWGHGRPGWHIECSAMAANNLGEIFDIHGG
GIDLIFPHHENEIAQSSCAFGHGTMANYWMHNGFVTVEGEVMSKSLRNFYTVHDLLSRWP
GEAIRLLLLSAHYRQPLNFSKFGLYKAKIQLDKLYGAINRAQESGYTPQSSLVQDNNLVF
SALCDDLNTPLALTALHQIARKLNIALTNKFCTWEISNLMYKLLNWGKLLGLLQSDVKVW
FKGEYGKEDTEIEALIAARGAARKAHNFKEADKIRDKFKARGIKLEDGIGNTTWKKMK
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
ttgagggcgccaacatatccacccggaatccaagacatgaagctcaagattaccaatacg
ctcatgcgcaaaaagcaagtatttcacacaatagatccattgaatgtgcgtgtatatgtc
tgcggaccgacagtatatgattatgctcacgtaggcaatgcgcggcctgctgtagttttt
gacgttttagtccgtttgttgcgacatatttatggtgaagcacatgttacttacgttact
aacataaccgatgttgacgataaaattattaatcgctctaaggagctaggaataacaatg
gaggtactaactagagaaataacaaatatatataaagcagatatggatgcgattggcgtt
aacaaacctaacgtacaaccacgtgctactgagcatataggagcgatgatcgcccttaca
caacgattaattaaccttagacatgcttatattactaataatcatgtgttattcaatgtt
cattctgcggctaattacggtcaactttcacgccgttacgaacaagagtttattgctgaa
tcgcgaattgatctagtctcttttaaacgcaacccatctgatttcgtcctgtggaaaccc
actgcaaatgaccaacaaggatgggatagtccatggggtcatgggcggccaggttggcac
atagaatgctcagctatggctgcaaataatttaggtgaaatatttgatatacacggtggt
ggaattgatctgatatttccacatcacgaaaacgagatcgcccagagtagctgtgctttt
ggccatggaactatggcaaattactggatgcataacggtttcgtaacggtagaaggtgaa
gtaatgtcgaaatcgcttcgtaacttttacactgtccacgatttactctctagatggcct
ggtgaagcaatccgtttgttgcttctttccgctcactatcgccaaccactaaatttttct
aagtttggtctgtataaagctaaaatccagctcgacaagctgtacggtgcaataaatcga
gcacaagaatctggttacactcctcagtctagtctagttcaagataataatctagtcttt
tctgctttgtgtgatgacctaaatacgccgttagcattaactgccctgcatcaaatcgct
cgaaaattaaatatcgcgcttaccaataaattttgtacttgggaaatatctaatctgatg
tataagttgctaaactggggcaaattattaggtttgcttcaaagcgatgttaaagtttgg
ttcaagggagaatatggcaaagaagacacagaaatcgaagcattaattgctgcacgcggt
gctgctcgcaaagcgcataactttaaagaagctgataaaattagagataaatttaaagcc
cgaggaatcaaactagaagacggaattggtaacactacttggaagaaaatgaaatag

DBGET integrated database retrieval system