KEGG   Thalassotalea sp. PS06: FNC98_12755Help
Entry
FNC98_12755       CDS       T06100                                 

Gene name
ggt
Definition
(GenBank) gamma-glutamyltransferase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
thap  Thalassotalea sp. PS06
Pathway
thap00430  Taurine and hypotaurine metabolism
thap00460  Cyanoamino acid metabolism
thap00480  Glutathione metabolism
thap01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thap00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    FNC98_12755 (ggt)
   00460 Cyanoamino acid metabolism
    FNC98_12755 (ggt)
   00480 Glutathione metabolism
    FNC98_12755 (ggt)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:thap01002]
    FNC98_12755 (ggt)
Enzymes [BR:thap01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     FNC98_12755 (ggt)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     FNC98_12755 (ggt)
Peptidases and inhibitors [BR:thap01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   FNC98_12755 (ggt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept DUF1499
Motif
Other DBs
NCBI-ProteinID: QDP03014
UniProt: A0A516HGX7
Position
complement(2889028..2890719)
Genome map
AA seq 563 aa AA seqDB search
MREDGRGDRVVGAPWATRSPVLAVNGMAATSHPLSTQVAIDILQQGGTAMDAAIAANAAI
GLMEPTGNGIGGDLFAIVWDPKTKQLHGLNGSGRSAKGQTLAQLKEKIGEVSQIPNWGTP
PVTVPGTVDAWFALHEKFGKLDMQENLAPAIQYAREGFPVTEVIAYYMDIYQKRYEKLFK
EGEIEEITNYQATFLIDGKAPTEGQVFKNPDLGNTLEKIAKGGRDAFYKGDIAKTMDSYF
KRIGGPLRYEDFASHSSNWIDPVSVNYRGYDVWELPPNGQGIAALQMLTVLENYDLKSMG
HNSADYLHVMTEAKKLAFEDRARFYADPDYQKINLDYLLSEKYGKERAKLIDMQRAAKEV
EHGDPKLIEGDTIYLTVADKDGMMVSLIQSNYRGMGTGLVADGLGFIFQNRGAQYSLTEG
HPNVYAPGKRPFHTIIPAFITKDNKPYMSFGLMGGAMQPQGHVQMVTNIVDFAMNVQQAG
DAARFHHKGSTSPTWEGRMKDSGVLELESGVKADVVKELQQRGHKVHITSGPFGGYQAIL
KDLSNGVYHGASEMRKDGQAQGY
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgcgagaagatggaagaggtgaccgcgtcgttggtgcgccttgggctacccgttctcca
gtgcttgcggttaatggtatggcggcaacgtcacacccgctatcgactcaggttgccatt
gatattttgcaacaaggcggcacagccatggacgcggcaattgcggcaaatgcggcgatt
ggtttgatggagccaaccggtaatggcattggtggcgatttgttcgccattgtctgggat
ccgaaaaccaagcagttacatggtttaaatggttcagggcgcagcgccaaaggtcagaca
ctggcgcagctaaaagaaaaaatcggtgaggtttcacaaatccctaactggggtacaccg
ccagttacggtgccgggtaccgtcgatgcctggtttgctttgcacgaaaagttcggcaaa
ttggacatgcaggaaaacctggctcctgcgattcaatatgccagagaaggttttccggtt
accgaagttatcgcctattacatggatatctaccaaaagcgctatgaaaagctttttaaa
gaaggtgagattgaagagatcactaactatcaggcaacatttttgattgatggtaaagcg
ccaaccgaaggacaggtatttaagaacccggatttgggcaataccttagaaaaaatcgct
aaaggcggacgcgatgcgttttacaaaggtgatatcgccaaaaccatggatagctatttc
aagcgcattggcgggccacttcgctatgaagattttgccagtcattcgagtaactggatt
gacccggtttcggtaaattatcgcggctatgatgtctgggaattaccgcctaatggccag
ggcattgccgcattgcagatgctaacggttctggaaaactatgatctgaaaagcatgggg
cataacagtgctgattatttgcatgtaatgaccgaagcgaaaaaactggcgtttgaagat
cgcgcccgtttttacgcggatccggattatcaaaagattaacctcgattacttattgtcg
gaaaagtacggtaaagagcgtgccaagctgattgatatgcagcgagctgctaaagaagtg
gagcatggcgatcctaaactaattgaaggcgataccatctaccttacggttgccgataaa
gacggcatgatggtaagcctgattcaaagtaattatcgcggtatgggaactgggttggta
gccgacggccttggttttattttccaaaaccgcggtgctcagtattcattaaccgaaggc
catccgaatgtatacgcgccgggtaagcgacctttccacaccattattccagcgtttatc
accaaagataataaaccttatatgagctttggtttgatggggggcgccatgcagccgcaa
ggccatgtacagatggttaccaatattgtcgattttgcgatgaacgtccaacaagccggc
gatgccgcccgttttcatcacaaaggctcaacctcaccgacctgggaaggacgaatgaaa
gacagtggtgtactagagctggaaagcggcgttaaagccgatgtcgttaaagagctgcaa
cagcgcggtcataaagtgcatatcaccagtggtccgtttggcggctatcaggctatctta
aaagatcttagtaacggtgtttatcatggtgccagtgaaatgcgtaaagatggccaggcg
caggggtattaa

DBGET integrated database retrieval system