KEGG   Rhodobacteraceae bacterium SH-1: C6Y53_03175Help
Entry
C6Y53_03175       CDS       T05357                                 

Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
thas  Rhodobacteraceae bacterium SH-1
Pathway
thas00670  One carbon pool by folate
thas01100  Metabolic pathways
thas01120  Microbial metabolism in diverse environments
thas01200  Carbon metabolism
Module
thas_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:thas00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    C6Y53_03175
Enzymes [BR:thas01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     C6Y53_03175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA
Motif
Other DBs
NCBI-ProteinID: AVO36790
UniProt: A0A2S0MLM8
Position
complement(642933..644609)
Genome map
AA seq 558 aa AA seqDB search
MSYKTDIEIAREANKKPIQEIGAMLGIPSDDLLPFGHDKAKVSADFIAAQKDRPDGRLIL
VTAINPTPAGEGKTTTTVGLGDALNRIGRKTAICIREASLGPCFGMKGGAAGGGYAQVVP
MEEMNLHFTGDFHAITSAHNLLSAMIDNHIYWGNELGIDERRVAWRRVMDMNDRALRQTV
VSLGGVANGFPREGGFDITVASEVMAILCLATDLADLQKRLGDIIVAYRRDRSPIYARDI
KADGAMTVLLQQAMQPNLVQTLENNPAFVHGGPFANIAHGCNSVIATTTALKLADYVVTE
AGFGADLGAEKFMNIKCRKAGLAPDCVVLVATVRAMKMNGGVAKSDLGVENVQAVVAGCP
NLGRHISNLKTFGVPVVVAINHFVTDTEAEIQAVKDYVTSQGSEAILSRHWELGGEGAED
LAHRVARIADSGVSQFAPLYRDDMGLFEKIEAIAKRIYRADEVLADKKIRDQLRQWEEAG
YGHLPVCMAKTQYSFSTDPNLRGAPTGHSVPVREVRLSAGAGFVVVICGEIMTMPGLPQV
PAAESIGLNETGQIEGLF
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgagctacaagaccgatatcgaaattgcccgcgaggcgaacaagaagccgatccaggag
attggcgcgatgctgggcatcccgtccgacgatctgctgccgtttggccatgacaaggcc
aaggtgtccgccgatttcatcgccgcccagaaggatcgccccgatggccggctcatcctc
gtgaccgcgatcaacccgacgcccgcgggcgagggcaagaccacgaccaccgtcgggctg
ggggacgcgctcaaccggatcggcaggaaaaccgcgatctgcattcgcgaggcctcgctc
ggcccctgtttcgggatgaagggcggcgccgcgggcggcggctatgcgcaggttgtgccg
atggaggagatgaaccttcatttcaccggcgatttccacgccatcaccagcgcccacaac
ctgctctcggcaatgatcgacaaccatatctactggggcaacgaactggggatcgacgaa
cgccgggtggcctggcggcgggtgatggacatgaacgaccgggcgctgcggcagaccgtg
gtgtcgctggggggtgtggccaacgggttcccgcgcgagggcgggttcgacatcaccgtc
gcctccgaggtgatggcgatcctgtgcctggccaccgacctggcggacctgcagaaacgg
ctgggcgacatcatcgtggcctatcgccgcgaccgcagcccgatctatgcccgcgacatc
aaggccgatggcgcgatgacggtgctgttgcagcaggcgatgcagcccaacctggtgcag
acgctggaaaacaaccctgccttcgtccatggcggcccgttcgccaatatcgcccatggc
tgcaattcggtcatcgccaccaccacggcgctgaaactggccgattacgttgtgaccgag
gccgggttcggggccgatctgggcgccgagaaattcatgaacataaaatgccgcaaggcc
ggcctggcgcccgattgcgtggtgctggtggcgaccgtgcgggcgatgaaaatgaatggc
ggcgtggccaaatccgacctgggggtggaaaacgtgcaggcggtggtggcgggatgtccg
aaccttggccgccacatttccaatctcaagaccttcggcgtgccggtggtggtggcgatc
aaccatttcgtcaccgataccgaggccgaaatccaggcggtgaaggactatgtgacgagc
cagggctccgaggcgatcctgtcccggcactgggaactgggcggcgaaggggcagaggat
cttgcccatcgcgtggcccgcattgccgatagcggcgtgtcgcaattcgcgccgctctat
cgcgacgacatgggcctgttcgaaaagatcgaagccatcgccaaacgcatctaccgcgcc
gacgaggtgctggccgacaagaagatccgcgaccagctgcgccagtgggaagaggccgga
tacggacacctgccggtctgcatggccaagacccagtattcgttctcgaccgacccgaac
ctgcgcggcgcgccgaccggccattcggtcccggtgcgcgaggtgcggttgtcggcgggg
gccggtttcgtggtggtgatctgcggcgagatcatgaccatgccggggctgccgcaagtg
ccggcggcggaatcgatcgggttgaacgaaaccggccagatcgaggggttgttctag

DBGET integrated database retrieval system