KEGG   Rhodobacteraceae bacterium SH-1: C6Y53_04575Help
Entry
C6Y53_04575       CDS       T05357                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
thas  Rhodobacteraceae bacterium SH-1
Pathway
thas00450  Selenocompound metabolism
thas00970  Aminoacyl-tRNA biosynthesis
thas01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thas00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    C6Y53_04575
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    C6Y53_04575
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:thas01007]
    C6Y53_04575
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:thas03016]
    C6Y53_04575
Enzymes [BR:thas01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     C6Y53_04575
Amino acid related enzymes [BR:thas01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   C6Y53_04575
Transfer RNA biogenesis [BR:thas03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    C6Y53_04575
 Prokaryotic type
   Other AARSs
    C6Y53_04575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 Anticodon_1
Motif
Other DBs
NCBI-ProteinID: AVO37048
UniProt: A0A2S0MMD9
Position
931488..933203
Genome map
AA seq 571 aa AA seqDB search
MARILITSAIPYINGIKHLGNLVGSQLPADLFARYQRGRGNEVMFLCATDEHGTPAELAA
AKAGQPVAEYCTGMHEVQADIARRFGLSFDHFGRSSSPQNHALTQHFAGRLADAGLIREV
AEKQVYSNADGRFLPDRYIEGTCPNCGYDRARGDQCENCTKQLDPTDLIDPRSAISGSTD
LEVRETKHLYLRQSALKDRLDAWIDSKSDWPVLTTSIAKKWLHDGDGLQDRGITRDLDWG
IPVKRGDRDWPGMEGKVFYVWFDAPIEYIACAAEWAEAHGRPDADWQRWWRTDKGAEDVR
YVQFMGKDNVPFHTLSFPATIIGSGEPWKLVDHLKSFNYLNYDGGQFSTSQGRGVFMDQA
LEILPADYWRWWLLSNCPESSDAEFTWENFQQGVNKDLADVLGNFVSRITKFCRSKFGEE
VPAGAYGEKEQALIADLTTRIRAYERHMEAMEVRKSAQELRAIWVAGNEYLQSAAPWSTF
KTDPDRAAAQVRLGLNLVRLYAVLSMPFIPDAGARMLAAMGSDDDSWPDDVAAALSTLSP
GHAFAVPDVLFAKITDDQREDWQGRFAGTRA
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atggcacggatcctcatcacctcggcaatcccgtatatcaacgggatcaagcatttgggc
aatctcgtcggcagccagctgcccgccgacctgttcgcccgctaccagcgcggccggggc
aacgaggtgatgttcctctgcgccaccgacgaacacggcaccccggccgaactggccgcg
gccaaggccggccagccggttgccgaatactgcaccgggatgcacgaggtgcaggcggat
atcgcgcgccgtttcgggctcagcttcgatcatttcgggcgatcctcgagcccgcagaac
cacgcgctgacccagcatttcgcgggccggctggccgatgccgggctgatccgcgaggtt
gcggagaaacaggtctattccaacgccgacgggcggttcctgcccgaccgctatatcgaa
ggcacctgccccaattgcggctacgaccgcgcccgtggcgaccagtgcgaaaactgcacc
aagcaactcgacccgaccgacctgatcgacccgcgcagcgcgatctcgggctcgaccgac
ctggaggtgcgcgaaaccaagcatctctacctgcgccagtcggcgctgaaggaccggctg
gacgcctggatcgacagcaagtccgactggccggtgctgaccacctcgatcgccaagaaa
tggctgcatgacggcgacgggttgcaggatcgcggcatcacccgcgatctcgactggggc
atcccggtgaaacgtggcgaccgggactggcccggcatggaaggcaaggtgttctacgtc
tggttcgacgcgcccatcgaatacatcgcctgcgccgccgaatgggccgaggcccatggc
aggccggatgccgactggcaacgctggtggcgcacggacaagggcgccgaggacgtgcgc
tacgtccagttcatgggcaaggacaacgtgccattccacaccctgtccttcccggccacg
atcatcgggtccggcgagccgtggaaactggtcgatcacctcaagagcttcaactatctc
aactatgatggcggccagttcagcacctcgcagggccgtggcgtgttcatggatcaggcg
ctggagatcctgccggcggattactggcgctggtggctgctgtcgaactgcccggaaagc
tcggatgccgaattcacctgggaaaacttccagcagggggtgaacaaggacctggccgac
gttctgggcaatttcgtgtcacggatcaccaagttctgccgctcgaaattcggcgaagag
gtcccggccggcgcctacggcgaaaaggaacaggccctgatcgccgatctgaccacccgc
atccgcgcctatgaacgccacatggaggcgatggaggtgcgcaaatccgcgcaggaattg
cgggcgatctgggtcgccggcaacgaatacctccaatccgccgcgccctggtccacgttc
aagaccgatcccgaccgcgcggcggcgcaggtgcggctggggctgaacctggtccggctc
tacgcggtgctgtcgatgccgttcattcccgatgccggcgcccggatgctggccgcgatg
ggcagcgacgacgacagctggcccgacgacgtcgccgccgcattgtccaccctgtcaccg
ggccacgcctttgccgtgcccgacgtgctgttcgccaagatcaccgacgaccagcgcgaa
gactggcagggccgtttcgccggcacccgcgcctga

DBGET integrated database retrieval system