KEGG   Thalassococcus sp. SH-1: C6Y53_07835Help
Entry
C6Y53_07835       CDS       T05357                                 

Definition
(GenBank) glutamate--tRNA ligase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
thas  Thalassococcus sp. SH-1
Pathway
thas00860  Porphyrin and chlorophyll metabolism
thas00970  Aminoacyl-tRNA biosynthesis
thas01100  Metabolic pathways
thas01110  Biosynthesis of secondary metabolites
thas01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:thas00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    C6Y53_07835
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    C6Y53_07835
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:thas01007]
    C6Y53_07835
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:thas03016]
    C6Y53_07835
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:thas02048]
    C6Y53_07835
Enzymes [BR:thas01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     C6Y53_07835
Amino acid related enzymes [BR:thas01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   C6Y53_07835
Transfer RNA biogenesis [BR:thas03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    C6Y53_07835
 Prokaryotic Type
   Other AARSs
    C6Y53_07835
Prokaryotic defense system [BR:thas02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    C6Y53_07835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AVO37621
UniProt: A0A2S0MPE1
Position
complement(1561059..1562384)
Genome map
AA seq 441 aa AA seqDB search
MTTTRFAPSPTGYLHVGNLRTALMNWLIARKAGGTFILRIDDTDPERSKEEYVDAIKQDL
EWLGLHWDRVERQSERLDRYAEAADRLRGMGRFYEAFETPTELDLKRKKLLNMGRPPVYD
RAALSLSEDEKAALRAERGNGVWRFKLDQERIEWPDGILGDVSIDAASVSDPVLIRGDGQ
VLYTLASVVDDTEMGVTDVVRGADHVTNTATQIQIIAALGGNCPRFAHHSLLTGPQGEAL
SKRLGVLALRDLRAAGVQPMALLSQMARLGSADPVELRSDMAALVDGFDVTRFGTAPTKF
DVEDLYPLTARHLQALPLEAVAVDVAALGVPDELAPAFWAVARDNITTLGDLGEWWALCR
DGAEPLIDEGDAEFVAKAIALLPEGPFDETSWASWTQAVKGATGRKGKGLFMPLRKALTG
REHGPDMSALMPLLQVIRARS
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccacccgtttcgccccgtcgcccaccggctatctccatgtcggcaatctgcgc
acggcgctgatgaactggctgatcgcacgcaaggcgggcggaaccttcattctgcgcatc
gacgacaccgacccggagcggtcgaaggaggaatatgtcgatgcgatcaagcaggatctc
gaatggctgggcctgcattgggaccgagtggaacggcagtcggagcggctggaccgctat
gccgaggcggccgaccggctacgcgggatgggccggttctacgaagcgttcgagaccccg
accgaactggacctgaagcgcaagaagctgctgaacatgggccgtccgccggtctatgac
cgcgccgcgctgtcattgtcggaggacgaaaaggccgcgctgcgcgccgagcgcggcaat
ggtgtctggcggttcaagctggaccaggaacggatcgaatggcccgacggcatcctcggc
gacgtgtcgatcgatgccgcaagcgtgtcggacccggtgctgatccgtggcgacgggcag
gtgctctatacgctggcctcggtggtggatgacaccgaaatgggggtgacggatgtggtg
cgcggggcggaccatgtcaccaacaccgcgacccagatccagatcatcgcggcgctcggt
ggcaactgcccgcgctttgcccaccattcgctgctgaccggcccgcagggcgaggcgctg
tcgaagcggctgggggtgctggcgctgcgcgacctgcgcgcggccggggtgcagccgatg
gcgctgctgagccagatggcgcggctgggctcggctgacccggtcgaactgcgctcggac
atggccgcgctggtcgacgggttcgacgtgacccggttcgggaccgccccgaccaagttc
gatgtcgaggatctctatccgctgacggcccgccacctgcaggcgctgccgctcgaggcg
gtcgccgtcgatgtcgcggcgctgggcgtgccggacgaactcgccccggctttctgggcc
gtggcgcgggacaatatcaccacgctcggcgatctcggcgaatggtgggcgctgtgccgc
gacggggccgagccgctgatcgacgagggcgatgccgagtttgtggcaaaggcgatcgcg
ctgttgcccgaggggccgttcgacgaaaccagctgggccagctggacgcaggcggtgaag
ggcgcgaccggccgcaagggcaaggggttgttcatgccgctgcgcaaggcgctgacgggg
cgggaacatggcccggacatgtcggcgctgatgccgctgctgcaggtgatccgcgcccgc
tcctga

DBGET integrated database retrieval system