KEGG   Rhodobacteraceae bacterium SH-1: C6Y53_10370Help
Entry
C6Y53_10370       CDS       T05357                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
thas  Rhodobacteraceae bacterium SH-1
Pathway
thas03010  Ribosome
Brite
KEGG Orthology (KO) [BR:thas00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    C6Y53_10370
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:thas03011]
    C6Y53_10370
Ribosome [BR:thas03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    C6Y53_10370
  Bacteria
    C6Y53_10370
  Archaea
    C6Y53_10370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 KORA Caenor_Her-1
Motif
Other DBs
NCBI-ProteinID: AVO38068
UniProt: A0A2S0MQB9
Position
2097410..2097790
Genome map
AA seq 126 aa AA seqDB search
MGKAKNPRRVAENEAMAKTRMLRTSPQKLNLVAAMIRGKKVEKALTDLTFSNKRIAQDVK
KCLQSAIANAENNHNLDVDELVVAEAYVGKNLTLKRGRPRARGRFGKIIKPFSELTIKVR
QVEEQA
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaggcaaagaacccccgccgcgtggccgaaaacgaagcaatggccaagacccgt
atgcttcgcacgtccccgcagaaactgaacctggtggcggcgatgatccgcggcaagaag
gtggaaaaggcgctgaccgatctcaccttctcgaacaagcggatcgcgcaggacgtgaag
aaatgccttcagtctgcgatcgccaacgccgagaacaaccacaacctggacgtggacgaa
ctggtcgtcgccgaggcctatgtgggcaagaacctgaccctgaaacgcggtcgcccgcgg
gcccgtggccggttcggcaagatcatcaagccgttctcggaactcaccatcaaggtgcgt
caagttgaggagcaagcctaa

DBGET integrated database retrieval system