KEGG   Rhodobacteraceae bacterium SH-1: C6Y53_14950Help
Entry
C6Y53_14950       CDS       T05357                                 

Definition
(GenBank) 4a-hydroxytetrahydrobiopterin dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
thas  Rhodobacteraceae bacterium SH-1
Pathway
thas00790  Folate biosynthesis
thas01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thas00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    C6Y53_14950
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:thas04147]
    C6Y53_14950
Enzymes [BR:thas01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     C6Y53_14950
Exosome [BR:thas04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   C6Y53_14950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: AVO38868
UniProt: A0A2S0MSJ2
Position
3047285..3047581
Genome map
AA seq 98 aa AA seqDB search
MSERLSEETRALLLAPLIENGWHPVEGRDAIAKTYEFATFVDAFGWMTRVALWAEKWNHH
PDWRNVYNRVEVELTTHDVGGLTARDAKLARKMDTLAG
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaacgtctgtccgaagaaacccgggcgctgctgctggcgccgctgatcgagaat
ggctggcacccggtcgaggggcgcgatgcgattgccaagacctatgaattcgcgaccttt
gtcgatgcgttcggatggatgacgcgggtcgcgctctgggccgagaaatggaaccaccat
cccgattggcgcaatgtctacaaccgggtcgaggtagaactgaccacccatgacgttggc
ggattgaccgcgcgggatgccaagctcgcccgcaagatggatacgctcgcgggctga

DBGET integrated database retrieval system